KEGG   Oceanobacillus iheyensis: OB1919Help
Entry
OB1919            CDS       T00093                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00010  Glycolysis / Gluconeogenesis
oih00052  Galactose metabolism
oih00500  Starch and sucrose metabolism
oih00520  Amino sugar and nucleotide sugar metabolism
oih00521  Streptomycin biosynthesis
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
Module
oih_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oih_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB1919
   00052 Galactose metabolism
    OB1919
   00500 Starch and sucrose metabolism
    OB1919
   00520 Amino sugar and nucleotide sugar metabolism
    OB1919
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OB1919
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    OB1919
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OB1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAC13875
JAMSTEC: OB1919
UniProt: Q8EQ10
Position
complement(1946831..1947808)
Genome map
AA seq 325 aa AA seqDB search
MDKHLLVGVDIGGTTVKIGFISEKGKVLDKWEISTNLLDGGKYIVPEIWSSVESKIKQLS
YSLSSIVGIGVGAPGFIDAEKGFVHEAVNIGWKNFALAEAFKAYVSIPVYVENDANTAVL
GENWVGAGNQADNLIAITLGTGVGGGIIANGRILNGANGMAGELGHMIVEEDGARCNCGN
QGCLETITSATGIVRQALEKVIEIPNSTLAEVYNKNGEITSKEIFDLAKEGDVAAKSIVD
HTADVLGKVLANMGVIINPSKVLIGGGVSKAGDQLIDAIQFAFEKHALPRVAEACSIKTA
QLGNDAGIIGAAYLVYSSKNSTFFT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaacatttattagtgggtgttgatattgggggtactacagttaaaataggcttt
atatcggaaaaagggaaggtactagacaagtgggaaatatctacaaatctacttgatggt
ggaaaatatattgtacccgaaatctggtcttctgtggagtctaaaataaagcagctaagt
tattctttgtcttcgatagttggaattggtgtaggagcgccaggatttattgatgcagaa
aagggatttgttcatgaagctgttaatattggttggaaaaattttgctttagctgaagct
tttaaagcttatgtgagtatccctgtatacgttgaaaatgatgccaatactgctgtgctt
ggagaaaattgggttggtgcagggaatcaagcagacaatttaattgcgattacacttgga
accggtgttggtggaggaatcatcgccaatggtcgaattttaaatggagctaatggaatg
gcaggagaattaggacatatgattgtggaagaggatggcgcacgttgtaattgtggtaat
caaggttgtttagaaacgataacttctgctacgggtattgtgagacaagcattagaaaaa
gtaattgaaatacctaattcaacattagcagaagtatataataaaaatggtgaaattact
tcaaaagagatttttgaccttgcaaaggaaggcgatgtcgcagcaaaatcgattgttgat
catactgctgatgtcttagggaaagtcttagcaaacatgggtgtgattataaatccatct
aaagtgttaattggcggtggagtttctaaagctggagatcagttaattgatgctatccaa
tttgcttttgaaaaacatgcattaccaagagttgcagaggcttgttcaattaaaactgct
caattaggaaatgatgcaggcattattggagcagcttacttggtatattcttcaaaaaat
agcacatttttcacttga

DBGET integrated database retrieval system