KEGG   Oceanobacillus iheyensis: OB1998Help
Entry
OB1998            CDS       T00093                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
oih  Oceanobacillus iheyensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:oih00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:oih00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
2022367..2023845
Genome map
AA seq 492 aa AA seqDB search
MNTYELISSLKIKQQIGKLPNTISSISHNSRQVDDNSLFICISGFTVDGHNFVAEAVENG
ATCIVAEREVNLDTNKATLIIVPDTNKAIATLAATFYKHPSHNLTIYGVTGTNGKTTVTT
IINHLLTDNELSTALIGTNGFQINKDIYSSSNNTTSDVLTNQHMLYEAKNQGVTHVAMEV
SSHGLEQGRLWGIDFTVATFTNLSHEHLDYHGSMEEYAATKVQLFSSLAIQPNKQKIAVL
NRDDNWYEYFQKRTPVQIVSYGIYEQADFRATAIKYYKDRTSFELLTPEGSFQVQTKLMG
EFNVYNVLAAIASVYVKESIPLTDLVKSIEGTPTPPGRMEKLESSGNRHIYIDYAHTPDA
LTKAINSLLPFKQNKLIVVVGTGGDRDKSIRPLLAKAASVADYVILTINDPRHEDPNNIL
QDLENGMLHHQYTCLENRKEAIREAINYSSPNDIILIAGKGKEPYQIIKNKKVAHNDATI
ALECSNELFPNI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacttatgaacttatttcatccttaaaaataaaacaacaaataggtaaattacct
aatactatttcctcaatttcacacaattctcgtcaagtggacgataactccttatttatt
tgtataagtggctttactgtagatggacataattttgtagccgaggctgtagagaatggt
gcaacgtgtattgtagcagaaagagaagttaatctcgatacaaataaagcgactttaatt
atagttcccgatacaaataaagctatagcaacacttgctgctactttttataaacatcca
tctcataatttaacgatatacggtgttacaggaacaaatggaaaaactacagtgacaacc
attattaatcatttattaacggataatgaactttctactgccctgattggaacgaatgga
ttccagataaataaagatatctattctagcagtaataatacaacaagtgatgttttaaca
aatcaacatatgctatatgaagcaaaaaatcaaggtgtgacacatgtggcaatggaagta
tcttcacatggattagaacaaggccgtctatgggggattgattttaccgttgctaccttc
accaacctgtcccatgaacatttggattatcatggtagtatggaagaatatgctgctacc
aaggtgcaattatttagttcgctagcaattcaacctaataaacaaaaaattgcagtgtta
aatcgagatgataattggtacgaatattttcagaaacgaacgcctgtacaaatcgtttcg
tatggaatttatgaacaggctgatttcagggctaccgctataaaatattataaagacaga
acttcatttgaactattaacaccagagggaagctttcaagtacaaacaaagcttatggga
gagtttaatgtttataatgttttagcagcgatcgcatccgtttatgtaaaagaatcaatt
cctttaacagatttagttaaatcaattgaagggactcctaccccacctggaagaatggaa
aaattagaaagtagtggaaatagacatatctatattgactatgctcatactccagatgca
ctaacaaaggcaattaatagtttacttccttttaaacaaaacaaattaattgttgttgta
ggaacaggtggtgatagagacaaaagtatacgtccgttattagccaaagctgcatctgtc
gcagattatgttatattaacgattaatgatccaagacatgaagatccgaataatatatta
caagaccttgaaaacggaatgttacatcatcaatatacgtgtcttgaaaatcgaaaagaa
gctattcgtgaggcaataaattattcttctcccaacgatattattttaattgcagggaaa
ggaaaagagccataccagattattaaaaataagaaggtagctcataatgatgctactatt
gcacttgaatgcagtaatgaattatttccaaatatatga

DBGET integrated database retrieval system