KEGG   Oceanobacillus iheyensis: OB2012Help
Entry
OB2012            CDS       T00093                                 

Definition
conjugation transfer protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
oih  Oceanobacillus iheyensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oih00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OB2012
Enzymes [BR:oih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OB2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2035532..2037862)
Genome map
AA seq 776 aa AA seqDB search
MTEQIMSEDQNVPLFAKGTVLTTIFQNAAEHFSIVRVQIDDTNLDYEDKEIIVKGYFDTL
QEQTAYCFYGELEKHPRYGTQLKVQSYETIIPSSRDGLISYLSSDLFYGVGKTTAERIVD
RLGEQAITKILDNDDALKGIKGLSKETAERLSNRLKENQGFEHVAVHLATYGIGLKMAQV
IYQTYKDEAIDLLKQDPYQFVFDIEGFGFRTADQIATQQGIAGTHESRIGAGIIFVLQRA
IQSGHVYVPLRDCLEEVVDLLRIATSDIEIVSFVFKQLNTAKKIIIIDEKVYLPSLYYAE
DGFAANLKRILDKPMEENIPMAEMLKIIGSIEEEEVLSYGKEQFDAINHAIHSKLMILTG
GPGTGKTTVIKGILKAYASLQKVSLDPKDYKNKSDFPFVLTAPTGRAAKRMTESTGIPAV
TIHRLLGWNGIGSFEKDEHEQLEGKLLIVDEFSMVDIWLANHLFKAIPADMQVLLVGDED
QLPSVGPGQVLTDLMHSNLLPTVSLQEVYRQKEGSKIIQLAHEIKQDNCSANSLSNDRDF
SFISCREPQMIEVISSVMKKAKAKGIDLNNIQVLAPMYRSQAGINIINQELQKLINPPTE
KRREIHYQDVIYRTGDRVIQLVNQPEDGVYNGDIGEIVAIFKPEENTEHEEQIVIAFEDR
EVVYIRKDYNNFTHAFCISIHKSQGSEFPIVLLPVVYAHHRMLRKNLLYTAITRSKESLI
ICGEQPAFLKGVNTKDTNQRNTSLKDALVTRIENESANEDSEQEQEEDEVSPYDFM
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaaattatgtctgaagatcaaaatgtacctttatttgccaaaggaaccgtt
ctgactacaatatttcaaaatgcagccgaacatttttcgattgttcgtgtccaaatagat
gacacgaatttagattatgaggataaggaaattattgtaaaaggatattttgataccctt
caagaacaaactgcttactgtttttatggtgaattagaaaaacatcctagatatggaaca
caactaaaggttcagtcttatgaaacaataataccaagttcaagagatggtttgataagt
tatctatcaagcgatctcttttatggcgttggaaaaacaactgcagagagaatagtagat
agactgggtgagcaggcaataacaaagattttggataatgatgatgctttaaagggaatt
aagggattatctaaagagacagcagaacgattatcaaatcgattaaaggaaaatcaagga
tttgaacatgtcgctgttcatttagcaacatatggaatcggcttaaagatggctcaagtt
atatatcagacgtataaagatgaagccatagatttattaaaacaagacccatatcagttt
gtatttgatatagagggatttggtttccgaacagccgatcaaatagctacccaacaagga
atagctggaacgcatgaaagtagaattggtgcagggattatctttgttttacagcgggca
attcaatctgggcacgtgtatgttcctttacgagattgtctagaagaagttgttgatttg
ttacgaattgcaactagtgatatagaaattgtttctttcgtttttaaacaattaaataca
gctaagaaaataatcatcatcgatgaaaaagtttatttaccttctctatattatgcagaa
gatggctttgcagctaatctaaagcgaatccttgataagccaatggaagaaaatatccct
atggcagaaatgttaaagattatcggttcgattgaagaagaagaggtattaagctacggg
aaagaacaatttgatgctattaatcatgccattcattctaaattaatgattttaacgggt
ggtcctggaacaggcaaaacaactgtgataaagggtattttaaaggcgtacgcgtccttg
caaaaggtatcattggacccaaaggattataagaataaatcagattttccatttgtactt
acagctcctacaggtagagcagcaaaacgcatgacagagtccacagggattcctgcagta
accattcatcgattattaggttggaacgggattggtagctttgaaaaagatgagcatgaa
caattagagggaaagttattaatcgtggatgaattttcgatggtagatatatggctagca
aatcatctatttaaagctattccagcggatatgcaagtgttattagtaggtgatgaagat
caacttccttctgtgggtccaggacaagttttaactgatctaatgcatagtaatttgtta
ccgacggtgtctcttcaagaggtataccggcaaaaggaaggttcaaaaatcattcagtta
gctcatgaaattaaacaagataattgttcagcaaattctttatccaatgatcgagatttt
agttttatttcatgtagagaacctcaaatgattgaagtgatatcttctgttatgaaaaaa
gcaaaagcaaaaggaattgatttgaataatattcaagtcttagctccaatgtatcgctcc
caagctggtattaatatcattaaccaggaattacaaaaattaataaatccaccaacggag
aagcgtagagaaattcattatcaagatgtgatttaccgaaccggtgatcgtgtcattcaa
cttgtcaatcaacctgaagatggtgtatataatggtgatattggtgaaatagtagcgata
ttcaaaccagaagaaaatacggaacatgaagaacaaattgtgattgcttttgaagatcga
gaagttgtttatattcgtaaagactataataatttcacacatgctttttgtatctcaatc
cataaatcacaagggagtgaatttccgattgtgctgttaccggttgtttatgcacatcac
cgtatgttgagaaagaatttattgtatacagcaataactagaagtaaagaatctctcatc
atatgtggagaacaacctgcatttcttaaaggtgtaaataccaaagacacaaatcaacgt
aatacttccttaaaggatgctttagttacacgaatagaaaatgaatctgcaaatgaagac
tctgaacaagaacaagaagaagatgaagtatccccatatgactttatgtaa

DBGET integrated database retrieval system