KEGG   Oceanobacillus iheyensis: OB2012Help
Entry
OB2012            CDS       T00093                                 

Definition
(GenBank) conjugation transfer protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oih00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OB2012
Enzymes [BR:oih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OB2012
DNA repair and recombination proteins [BR:oih03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     OB2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 HHH_5 AAA_11 AAA_14 UvrD_C AAA_12 AAA_33 Zeta_toxin T2SSE AAA AAA_16 TsaE AAA_22 DUF4926 NACHT RsgA_GTPase AAA_28 DUF815 AAA_18 NTPase_1 AAA_29 ABC_tran UvrD-helicase AAA_5 AAA_23
Motif
Other DBs
NCBI-ProteinID: BAC13968
JAMSTEC: OB2012
UniProt: Q8EPS6
Position
complement(2035532..2037862)
Genome map
AA seq 776 aa AA seqDB search
MTEQIMSEDQNVPLFAKGTVLTTIFQNAAEHFSIVRVQIDDTNLDYEDKEIIVKGYFDTL
QEQTAYCFYGELEKHPRYGTQLKVQSYETIIPSSRDGLISYLSSDLFYGVGKTTAERIVD
RLGEQAITKILDNDDALKGIKGLSKETAERLSNRLKENQGFEHVAVHLATYGIGLKMAQV
IYQTYKDEAIDLLKQDPYQFVFDIEGFGFRTADQIATQQGIAGTHESRIGAGIIFVLQRA
IQSGHVYVPLRDCLEEVVDLLRIATSDIEIVSFVFKQLNTAKKIIIIDEKVYLPSLYYAE
DGFAANLKRILDKPMEENIPMAEMLKIIGSIEEEEVLSYGKEQFDAINHAIHSKLMILTG
GPGTGKTTVIKGILKAYASLQKVSLDPKDYKNKSDFPFVLTAPTGRAAKRMTESTGIPAV
TIHRLLGWNGIGSFEKDEHEQLEGKLLIVDEFSMVDIWLANHLFKAIPADMQVLLVGDED
QLPSVGPGQVLTDLMHSNLLPTVSLQEVYRQKEGSKIIQLAHEIKQDNCSANSLSNDRDF
SFISCREPQMIEVISSVMKKAKAKGIDLNNIQVLAPMYRSQAGINIINQELQKLINPPTE
KRREIHYQDVIYRTGDRVIQLVNQPEDGVYNGDIGEIVAIFKPEENTEHEEQIVIAFEDR
EVVYIRKDYNNFTHAFCISIHKSQGSEFPIVLLPVVYAHHRMLRKNLLYTAITRSKESLI
ICGEQPAFLKGVNTKDTNQRNTSLKDALVTRIENESANEDSEQEQEEDEVSPYDFM
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaaattatgtctgaagatcaaaatgtacctttatttgccaaaggaaccgtt
ctgactacaatatttcaaaatgcagccgaacatttttcgattgttcgtgtccaaatagat
gacacgaatttagattatgaggataaggaaattattgtaaaaggatattttgataccctt
caagaacaaactgcttactgtttttatggtgaattagaaaaacatcctagatatggaaca
caactaaaggttcagtcttatgaaacaataataccaagttcaagagatggtttgataagt
tatctatcaagcgatctcttttatggcgttggaaaaacaactgcagagagaatagtagat
agactgggtgagcaggcaataacaaagattttggataatgatgatgctttaaagggaatt
aagggattatctaaagagacagcagaacgattatcaaatcgattaaaggaaaatcaagga
tttgaacatgtcgctgttcatttagcaacatatggaatcggcttaaagatggctcaagtt
atatatcagacgtataaagatgaagccatagatttattaaaacaagacccatatcagttt
gtatttgatatagagggatttggtttccgaacagccgatcaaatagctacccaacaagga
atagctggaacgcatgaaagtagaattggtgcagggattatctttgttttacagcgggca
attcaatctgggcacgtgtatgttcctttacgagattgtctagaagaagttgttgatttg
ttacgaattgcaactagtgatatagaaattgtttctttcgtttttaaacaattaaataca
gctaagaaaataatcatcatcgatgaaaaagtttatttaccttctctatattatgcagaa
gatggctttgcagctaatctaaagcgaatccttgataagccaatggaagaaaatatccct
atggcagaaatgttaaagattatcggttcgattgaagaagaagaggtattaagctacggg
aaagaacaatttgatgctattaatcatgccattcattctaaattaatgattttaacgggt
ggtcctggaacaggcaaaacaactgtgataaagggtattttaaaggcgtacgcgtccttg
caaaaggtatcattggacccaaaggattataagaataaatcagattttccatttgtactt
acagctcctacaggtagagcagcaaaacgcatgacagagtccacagggattcctgcagta
accattcatcgattattaggttggaacgggattggtagctttgaaaaagatgagcatgaa
caattagagggaaagttattaatcgtggatgaattttcgatggtagatatatggctagca
aatcatctatttaaagctattccagcggatatgcaagtgttattagtaggtgatgaagat
caacttccttctgtgggtccaggacaagttttaactgatctaatgcatagtaatttgtta
ccgacggtgtctcttcaagaggtataccggcaaaaggaaggttcaaaaatcattcagtta
gctcatgaaattaaacaagataattgttcagcaaattctttatccaatgatcgagatttt
agttttatttcatgtagagaacctcaaatgattgaagtgatatcttctgttatgaaaaaa
gcaaaagcaaaaggaattgatttgaataatattcaagtcttagctccaatgtatcgctcc
caagctggtattaatatcattaaccaggaattacaaaaattaataaatccaccaacggag
aagcgtagagaaattcattatcaagatgtgatttaccgaaccggtgatcgtgtcattcaa
cttgtcaatcaacctgaagatggtgtatataatggtgatattggtgaaatagtagcgata
ttcaaaccagaagaaaatacggaacatgaagaacaaattgtgattgcttttgaagatcga
gaagttgtttatattcgtaaagactataataatttcacacatgctttttgtatctcaatc
cataaatcacaagggagtgaatttccgattgtgctgttaccggttgtttatgcacatcac
cgtatgttgagaaagaatttattgtatacagcaataactagaagtaaagaatctctcatc
atatgtggagaacaacctgcatttcttaaaggtgtaaataccaaagacacaaatcaacgt
aatacttccttaaaggatgctttagttacacgaatagaaaatgaatctgcaaatgaagac
tctgaacaagaacaagaagaagatgaagtatccccatatgactttatgtaa

DBGET integrated database retrieval system