KEGG   Oceanobacillus iheyensis: OB2037Help
Entry
OB2037            CDS       T00093                                 

Gene name
ruvA
Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
oih  Oceanobacillus iheyensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oih00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OB2037 (ruvA)
Enzymes [BR:oih01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OB2037 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2065715..2066320)
Genome map
AA seq 201 aa AA seqDB search
MIAYIKGTLNSLGDESLIVDVGGIGYEIVCPNPFVFQDLLNQQIHIQTYHHVREDAQILF
GFQNRDEKYLFTKLISVSGIGPKGALAILAGVDISGFIAAVENEDDKFLTSFPGVGKKTA
RQIILDLKGKLTSVFSITDEQQKSSVSNVNNNEVYSEAMEALKALGYTDKEVKQVLPHLK
KDNDALSVDEAIRKALALLAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatatattaaaggtactttgaattccttaggggatgaatcgcttattgtagat
gtaggtggaattggttatgaaatagtgtgcccaaacccttttgtttttcaagatttactc
aatcagcaaatacatatacaaacctatcatcatgtgcgagaggatgcacaaattcttttt
ggttttcaaaatagagatgagaaatacttatttacgaagttaatatctgtttcaggaatt
ggtccaaagggagctttagctattttagcaggagtggatatatcagggtttattgctgca
gttgaaaatgaggatgataagttcttaactagttttcctggtgttggaaaaaagacagca
agacaaatcattcttgatttaaaaggaaagttaacaagtgtattctccataactgatgaa
cagcaaaagagtagtgttagtaatgtcaataataatgaagtatattctgaagcgatggaa
gcactgaaggcactaggttatacagataaagaggttaagcaagtactacctcatttaaag
aaggataatgatgcgttaagtgtagatgaagctattcgcaaagcattagcattattagca
aagtag

DBGET integrated database retrieval system