KEGG   Oceanobacillus iheyensis: OB2120Help
Entry
OB2120            CDS       T00093                                 

Definition
(GenBank) enoyl-CoA hydratase (3-hydroxybutyryl-CoA dehydratase)
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00071  Fatty acid degradation
oih00362  Benzoate degradation
oih01100  Metabolic pathways
oih01120  Microbial metabolism in diverse environments
oih01212  Fatty acid metabolism
Module
oih_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    OB2120
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OB2120
Enzymes [BR:oih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OB2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF4111
Motif
Other DBs
NCBI-ProteinID: BAC14076
JAMSTEC: OB2120
UniProt: Q8EPI5
Position
complement(2153644..2154417)
Genome map
AA seq 257 aa AA seqDB search
MTLIAFELKDQVACLTIQSPPANALSGAILKQLNERLNQIEEEGKAKAVVISGEGRFFSA
GADIKEFTGYQHASEYESLANNGQNVFDRVEHFSIPVIAAIHGAALGGGLELAMSCHIRL
VTENTKLGLPEMNLGIIPGFAGTQRLPRLIGNARAYEMILTGEPISGQQAADWGLANHVV
PEEELLQKAMNIANKITMKSKPGISEIMHLVPYANKDQLSKGVKEEAKSFGRVFGSEDAK
EGVTAFIEKREPNFQDK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgacgttaatagcttttgaattaaaagatcaagttgcctgtttgactattcaaagtcca
cctgccaatgcgttatcaggggcaatattgaaacaactcaatgaacgacttaatcaaata
gaagaagaaggtaaagcgaaggcagttgttatttcgggtgaaggtagattcttctctgct
ggagcagatattaaagaattcactggatatcaacatgcatctgaatatgaatctcttgcc
aataatgggcaaaacgtatttgatcgtgtagaacatttttctatccctgtaattgcagct
atacatggagctgcgcttggtgggggtcttgaacttgcaatgtcatgtcatattcgatta
gttactgagaatacaaagttaggattaccagaaatgaatttgggtatcattcctggtttt
gcaggaactcaacgtttaccacgacttatcgggaatgcacgagcttatgaaatgatatta
acaggggaaccaataagtggacagcaggctgctgattggggattggcgaatcatgtagtt
ccagaagaagaattgctgcaaaaagcaatgaacattgcgaataaaattactatgaaaagt
aagcctggtatttcagagataatgcatttagttccatatgcaaataaagatcaactctca
aaaggtgtaaaggaagaagcaaagtcttttggcagggtatttgggtctgaagatgcaaaa
gaaggtgtcacagcatttattgaaaaacgagaaccaaatttccaagataaatag

DBGET integrated database retrieval system