KEGG   Oceanobacillus iheyensis: OB2162Help
Entry
OB2162            CDS       T00093                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
oih  Oceanobacillus iheyensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:oih03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2193996..2194838)
Genome map
AA seq 280 aa AA seqDB search
MPELPEVETIKETLKLFVCNKTIKHIDIEWPNMIKHPDDVEEFKALVTGQTIRSMGRKGK
FLLFYLDEYVLISHLRMEGKYSVHSPGDPVKKHTHVTFYFSNGEELRYNDVRKFGTMHVY
PIGEEFMHKPLNQLGPDPFDTSFNLEYFYEKLKRTDRYIKTALLDQSIVTGLGNIYVDET
LFRANVHPLKRCSKLSKQEVKKLQINAKETLRDAIKAGGTTIRSYVNTQGDMGMFQQDLY
VYGQHSKPCRVCGADIIKIKVGGRGTHLCPTCQPNKQGVR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagtagaaacaataaaagaaacattgaaactttttgtatgcaat
aaaacgatcaagcatattgatattgagtggccaaatatgattaagcatcctgacgatgtt
gaggaatttaaagcattagttactggtcaaacgattcgttcaatgggaagaaaaggaaaa
tttcttttgttttatcttgatgaatatgttcttatctcccatttgcggatggaaggaaag
tatagtgttcattctccaggagatccagtaaaaaaacatacccatgtaacgttctatttt
tcaaatggagaagaattacgttataacgatgttcggaaattcggaaccatgcatgtttat
ccaattggtgaagagtttatgcataaacctttaaaccaacttggtcctgatccgtttgac
acatcgtttaatttagaatacttttatgaaaaattgaagcgaacagatcgatatattaaa
acagctttgttagatcaatcaattgttactggactggggaatatttatgtggacgagacc
ttgtttcgggcgaatgttcatccgctgaaacgttgtagcaagttatcgaaacaagaagta
aaaaagttacaaataaatgcaaaggaaacattacgagatgcaattaaagctggaggtaca
acgattcgtagttatgtgaatacccaaggagatatggggatgtttcaacaagatttatat
gtttatggtcagcattctaagccgtgtagagtttgcggcgcagatattattaaaataaag
gttggtggaagaggcactcatctatgtcctacttgccagccgaataagcaaggtgtgaga
taa

DBGET integrated database retrieval system