KEGG   Oceanobacillus iheyensis: OB2172Help
Entry
OB2172            CDS       T00093                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oih  Oceanobacillus iheyensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OB2172 (pfkA)
   01230 Biosynthesis of amino acids
    OB2172 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2172 (pfkA)
   00030 Pentose phosphate pathway
    OB2172 (pfkA)
   00051 Fructose and mannose metabolism
    OB2172 (pfkA)
   00052 Galactose metabolism
    OB2172 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    OB2172 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    OB2172 (pfkA)
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     OB2172 (pfkA)
Protein phosphatases and associated proteins [BR:oih01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     OB2172 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2207510..2208469)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDLEVYGIKNGYQGLMDGNIEKMTLGSVGDI
IHRGGTILFSARSEEFKTDEGQFRAIEQLNKHNIDGLVVIGGDGSFQGAKKLTEKGFPCI
GVPGTIDNDIAGTDYTIGFDTSLNTIIDAVDKVRDTATSHERTYIIEVMGRDAGDLALWA
GLAVGAESILIPEEKEDFSSIVQRLKNGHDRGKKHSIILLAEGVGSGFEFGKRIEEVAEL
ETRVTVLGHIQRGGSPTGQDRVLASRLGARAIELLIDNQGGRMVGIQKNVLVDYTFDEVF
NVEHTIDKGMYKLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataggagtattaacaagtggcggtgattctcctggtatgaacgctgctatc
cgtgcggttgttcgtaaggcgatttatcatgacctagaagtttacggtattaaaaatggt
tatcaaggattaatggatggcaatattgaaaaaatgactttagggtctgtaggtgatatt
attcatcgaggtggaacaatactgttttctgccagaagtgaagaatttaaaacagatgag
ggtcaatttcgagctattgaacaacttaataagcataatatagatggtttagttgttatt
ggaggagatggaagcttccaaggtgcaaaaaaattaaccgagaaaggttttccatgtata
ggtgtaccgggtacgattgataacgatattgcaggtacagattatacaattggttttgat
acatcattaaatacaattatagatgctgtcgataaagtacgagatactgctacatctcat
gaaagaacttacattattgaagtaatgggaagagatgctggtgacctagcactatgggct
gggttagctgttggcgcagaaagtatattgataccggaggaaaaagaagacttctccagt
attgttcaacgcttaaaaaatggacatgaccgtggcaaaaaacatagtatcatcttatta
gctgaaggtgttggtagtggctttgaattcggtaagcgaattgaagaagttgcagaactt
gagactagagttacagttttaggtcatattcagcgtggtggatcacccacagggcaagat
cgtgttcttgcaagcagattgggagccagagctattgaattgttgattgataatcaaggt
ggaagaatggttggaattcaaaaaaacgtattagtggattatacatttgatgaagtgttc
aatgttgaacatacaatcgataaaggaatgtataaactttcgaaagaattatcaatctaa

DBGET integrated database retrieval system