KEGG   Oceanobacillus iheyensis: OB2172Help
Entry
OB2172            CDS       T00093                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00010  Glycolysis / Gluconeogenesis
oih00030  Pentose phosphate pathway
oih00051  Fructose and mannose metabolism
oih00052  Galactose metabolism
oih00680  Methane metabolism
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
oih01230  Biosynthesis of amino acids
oih03018  RNA degradation
Module
oih_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oih_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2172 (pfk)
   00030 Pentose phosphate pathway
    OB2172 (pfk)
   00051 Fructose and mannose metabolism
    OB2172 (pfk)
   00052 Galactose metabolism
    OB2172 (pfk)
  Energy metabolism
   00680 Methane metabolism
    OB2172 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    OB2172 (pfk)
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     OB2172 (pfk)
Protein phosphatases and associated proteins [BR:oih01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     OB2172 (pfk)
Messenger RNA biogenesis [BR:oih03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     OB2172 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: BAC14128
JAMSTEC: OB2172
UniProt: Q8EPD6
Position
complement(2207510..2208469)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDLEVYGIKNGYQGLMDGNIEKMTLGSVGDI
IHRGGTILFSARSEEFKTDEGQFRAIEQLNKHNIDGLVVIGGDGSFQGAKKLTEKGFPCI
GVPGTIDNDIAGTDYTIGFDTSLNTIIDAVDKVRDTATSHERTYIIEVMGRDAGDLALWA
GLAVGAESILIPEEKEDFSSIVQRLKNGHDRGKKHSIILLAEGVGSGFEFGKRIEEVAEL
ETRVTVLGHIQRGGSPTGQDRVLASRLGARAIELLIDNQGGRMVGIQKNVLVDYTFDEVF
NVEHTIDKGMYKLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataggagtattaacaagtggcggtgattctcctggtatgaacgctgctatc
cgtgcggttgttcgtaaggcgatttatcatgacctagaagtttacggtattaaaaatggt
tatcaaggattaatggatggcaatattgaaaaaatgactttagggtctgtaggtgatatt
attcatcgaggtggaacaatactgttttctgccagaagtgaagaatttaaaacagatgag
ggtcaatttcgagctattgaacaacttaataagcataatatagatggtttagttgttatt
ggaggagatggaagcttccaaggtgcaaaaaaattaaccgagaaaggttttccatgtata
ggtgtaccgggtacgattgataacgatattgcaggtacagattatacaattggttttgat
acatcattaaatacaattatagatgctgtcgataaagtacgagatactgctacatctcat
gaaagaacttacattattgaagtaatgggaagagatgctggtgacctagcactatgggct
gggttagctgttggcgcagaaagtatattgataccggaggaaaaagaagacttctccagt
attgttcaacgcttaaaaaatggacatgaccgtggcaaaaaacatagtatcatcttatta
gctgaaggtgttggtagtggctttgaattcggtaagcgaattgaagaagttgcagaactt
gagactagagttacagttttaggtcatattcagcgtggtggatcacccacagggcaagat
cgtgttcttgcaagcagattgggagccagagctattgaattgttgattgataatcaaggt
ggaagaatggttggaattcaaaaaaacgtattagtggattatacatttgatgaagtgttc
aatgttgaacatacaatcgataaaggaatgtataaactttcgaaagaattatcaatctaa

DBGET integrated database retrieval system