KEGG   Oceanobacillus iheyensis: OB2208Help
Entry
OB2208            CDS       T00093                                 

Definition
(RefSeq) aldose 1-epimerase (EC:5.1.3.3)
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
oih  Oceanobacillus iheyensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2208
   00052 Galactose metabolism
    OB2208
Enzymes [BR:oih01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     OB2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2243237..2244271)
Genome map
AA seq 344 aa AA seqDB search
MQIRRENVHNNWKQFTLINDRDMEVSILNYGGIITRIITPDRNEQKRNIVARYKNLDDYI
ENPLYLGAIIGRVAGRIQNGSFSIGDKEIQLQANEGYHVLHGGKSGFHQILWDVTTIEKP
DYVGIRLTYTSKENESDFPGNVNVAITYYLDNQNELTIDYNAISDKQTPITLTNHSYFNL
SGDLEQTIHEHEMTLDSDQFLELDEELIPTGEMVDVDMTPFDFRSGRCLSIGLNNDFYQN
KIVGSGYDHFFLFNHEKKHVVNMVEPRSGRQLFISTNQPGMVMYTSNSVDSSQQFYEGEA
KKYIAVCFETQGSPASLHHDNLETILLEANQPYQKTTTFQFGVI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtagagaaaatgtacataataattggaaacaatttacattaattaacgat
cgtgacatggaagtttctatattaaattatggagggattattacacgtattataacgcca
gataggaatgaacagaaaagaaatattgttgcacgatataaaaatttagatgattatatc
gagaatccattatatcttggggcgataattggtagagtggcaggaagaattcaaaatggt
agtttttccataggagataaagaaattcaattacaagccaacgaaggttatcatgtgctt
catggtgggaagagtggatttcatcagatcttatgggatgtaacaacaattgaaaaaccg
gactatgtaggaattcgactaacttatacaagtaaagagaatgaaagtgattttccaggt
aatgtgaatgtagctattacgtactatttggataatcaaaatgaattaacaattgattat
aatgcaataagtgataagcagactccgattacattgacgaatcactcgtattttaattta
agtggagatctagaacaaaccatacatgaacatgagatgacattggacagtgatcagttt
ctggaactagatgaagaattgattccaacaggagaaatggtagatgtagatatgacacca
tttgattttcgaagcggacgttgtctgagtattggcttaaacaacgatttctatcagaat
aagattgttggatcgggatatgatcacttttttctatttaatcatgaaaaaaaacatgtc
gtgaatatggttgaacctagaagtggcaggcagctctttatttctactaatcaaccaggg
atggtcatgtatacatcaaattcggtagattctagtcagcaattttatgaaggcgaggca
aagaaatacattgccgtgtgttttgaaactcaggggagccctgcatctttacaccatgat
aaccttgaaacaattctattagaagcgaatcagccttatcaaaaaacaacaacattccag
tttggggtaatttag

DBGET integrated database retrieval system