KEGG   Oceanobacillus iheyensis: OB2238Help
Entry
OB2238            CDS       T00093                                 

Definition
(GenBank) endo-1,4-beta-glucanase (EC 3.2.1.4) (EC:3.2.1.4)
Organism
oih  Oceanobacillus iheyensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JAMSTEC: 
UniProt: 
Position
complement(2277837..2278907)
Genome map
AA seq 356 aa AA seqDB search
MRVERETLSLFKTLTELQGAPGNEHPVRNFMKGELEKYSDEVIQDNLGGTFGVKHGNGPR
VMVAGHMDEVGFMVTQITDNGMLRFQPLGGWWNQVMLAQRVQVMTANGPVIGVIGSIPPH
LLTEAQRSKPMEIKNMLIDIGADDKEDVKKIGVKPGDSIVPITPFEPMANEKKILAKAWD
NRYGCGLAIELLKELQNEQLPNQLYSGATVQEEVGLRGAQVAANMIQPDVFYALDASPAN
DASGDKQAFGQLGKGALLRIFDRTMVTHNGMREYVLDTAESNNIPYQYFISQGGTDAGRV
HLANDGVPSAVVGICSRYIHTSASIIHVDDYAAAKELLIKLVKGTDSSFVSQLKEK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagagtggagagagaaacgctatcgctttttaaaacattaacggaactacaaggtgca
cctggtaatgaacacccggtacgtaattttatgaagggtgaattagaaaaatattcggat
gaggttatacaagataatctaggcggaacttttggtgtgaagcatgggaatggacctaga
gttatggtggcaggtcacatggatgaagttggatttatggtcacacaaattacagataac
ggcatgttacgctttcaaccacttggtggttggtggaatcaagttatgcttgcacaaaga
gttcaggttatgactgcaaacggaccggttattggggttattggttcgataccgccccat
ttacttacggaggcgcaacgcagtaaaccaatggaaattaaaaatatgcttattgatatt
ggtgcagacgataaagaagatgtaaagaaaataggtgtaaagccaggcgacagtatcgtt
ccaatcacaccattcgagcctatggccaatgaaaaaaagattttagcaaaagcttgggat
aatcgttatggatgcggattagctattgaattgttaaaagagttacaaaatgaacagcta
ccaaatcagctatattctggagcaacggtacaggaagaagttggacttagaggagcacaa
gtagcggcaaatatgattcaacctgatgtgttctatgcattagatgcatctccagccaat
gatgcttctggagataaacaagcatttggtcaattaggaaaaggagcattacttcgtata
tttgatcgaacaatggtaacacataatggtatgcgagaatatgtacttgatactgcagaa
agcaataatattccatatcagtattttatctcacaaggaggaacagatgcaggtcgtgta
catcttgctaatgatggagttccctctgcagtagtcggaatttgttcacgctatattcac
acttcagcgtctattattcatgtagatgattatgcagctgcaaaagaattgcttataaaa
ttagttaaaggtacagatagttccttcgtatcccaattaaaagaaaaataa

DBGET integrated database retrieval system