KEGG   Oceanobacillus iheyensis: OB2407Help
Entry
OB2407            CDS       T00093                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OB2407
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    OB2407
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OB2407
Enzymes [BR:oih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     OB2407
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OB2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2461475..2462083)
Genome map
AA seq 202 aa AA seqDB search
MNDWVTGIMEQLGYLGIFLMMALENLFPPIPSEIVLPFGGFLTTYTNLTILGVITAATLG
SVIGSMVLYCIGTFLDIPRLERLIDRYGQWIRLKLSDVQRANDWFQRRGYWTVFFCRMVP
VIRSLISIPAGMTRMNFPIFIFLTTLGTILWNVILISFGVALGENWQQILGFMHVYSRFV
YIAIIIILVVIAIILFKRKRQR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactgggttacgggtattatggaacagttaggttacttagggatttttttaatg
atggctttagagaatctatttccacctattccatcagaaattgtattaccgtttggggga
tttttaactacttatacaaatctaacaatattaggtgttataacagctgctacgcttgga
tctgtcattggttctatggtactttattgtattggaacatttttagacatacctcgatta
gagagattaatcgatcgatatggacagtggattcgtttgaaattatcggatgtacagcga
gccaatgattggtttcaacgtagaggctattggactgtttttttctgtagaatggtcccg
gtaataagaagccttatatctattccagctggtatgacaaggatgaatttccctattttt
atttttttaactactcttggtacaattttatggaatgttatattaattagttttggtgtt
gctttaggagaaaactggcagcaaatattaggattcatgcatgtatactcaagatttgta
tatatcgccattattatcatactagtagtaatcgctattatattatttaaaagaaaacgt
caacgctag

DBGET integrated database retrieval system