KEGG   Oceanobacillus iheyensis: OB2429Help
Entry
OB2429            CDS       T00093                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
oih  Oceanobacillus iheyensis
Brite
Enzymes [BR:oih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     OB2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 BAAT_C Abhydrolase_6 DLH DUF2048 Peptidase_S9 PAH DUF1340 Abhydrolase_3 Abhydrolase_5 FSH1 DUF713
Motif
Other DBs
NCBI-ProteinID: BAC14385
JAMSTEC: OB2429
UniProt: Q8ENP9
Position
complement(2483410..2484150)
Genome map
AA seq 246 aa AA seqDB search
MKIKLPEPFTFEAGDKAVLLLHGFTGHSADVRMLGRFLEKKGYTSHAPIYRGHGQPPEEL
IKSNPEQWWADVEAAYNHLQDLGYEEIAVAGLSLGGVLGLKLAYSKNIKGIVTMCSPMFF
DNEQELTKGFRQFSTEFKQLEKKDKEVIEEEVNQLMDQSKDLFKGVATTINEVKTNIDMI
YTPTFVVQAKNDKMINTDSANYIYENVEASKKDMKWYEESGHVITMDKEKDQLHEDIYQF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaattaccagagccatttacatttgaagcaggagataaagctgtattatta
ctacatggatttaccggtcattctgcagacgtacgtatgctaggtagatttttggagaaa
aaagggtatacttcacatgcaccaatttatagaggacatggacaacctcctgaagaatta
attaaaagtaaccctgaacaatggtgggcagatgtggaagctgcatataatcacttgcaa
gatttgggttatgaagaaattgcagttgctggcctttctttaggtggtgtgttaggactt
aaattagcttattccaaaaatatcaaaggtattgtaacgatgtgttctcctatgtttttt
gataatgaacaggaattgacaaaggggttccgtcaattttccacagaatttaaacagctg
gagaaaaaagataaagaagttatcgaagaagaagtaaatcaattaatggatcaatctaaa
gacttatttaagggtgtagctacaacgattaatgaagtaaagacaaatatcgatatgatc
tatactccgacatttgtggtacaagctaagaatgacaagatgattaataccgacagtgcc
aattatatttatgaaaatgtagaagcttccaaaaaagatatgaaatggtatgaagagtct
ggtcatgttattacgatggacaaagaaaaagatcagcttcatgaggatatttatcaattt
ctagaaagtttagattggtaa

DBGET integrated database retrieval system