KEGG   Oceanobacillus iheyensis: OB2436Help
Entry
OB2436            CDS       T00093                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OB2436 (tpi)
   01230 Biosynthesis of amino acids
    OB2436 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2436 (tpi)
   00051 Fructose and mannose metabolism
    OB2436 (tpi)
   00562 Inositol phosphate metabolism
    OB2436 (tpi)
Enzymes [BR:oih01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OB2436 (tpi)
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OB2436 (tpi)
  Exosomal proteins of bladder cancer cells
   OB2436 (tpi)
  Exosomal proteins of melanoma cells
   OB2436 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2491393..2492151)
Genome map
AA seq 252 aa AA seqDB search
MRKKVIAGNWKMNKVLSEAGEFMNSVVPKAPKGNDVEAIVCAPFPFLSKLVEQAKGSEVK
VAAQNMHFEDSGAFTGEVSPVMLKDLGVTHVVLGHSERRELFAETNELVNKKTKAAFAHD
LTPIVCVGETLDQREANETMNIVGEQVKQAVAGLTNEQVAETIIAYEPVWAIGTGKTATS
EQANEVCTEIRKVVAEVTSADVAEKVIIQYGGSVKPANVDELLAQSDIDGALVGGASLDP
ESFLQLVEAGTK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaagtgatagctggtaactggaaaatgaataaagtactatctgaagcagga
gaatttatgaattctgtagtaccaaaagctccgaaaggaaatgacgtagaagcaattgtg
tgtgctccattccctttcctgtcaaaattagttgagcaagcgaagggatcagaagtaaaa
gtagcagcgcaaaacatgcattttgaagattctggtgcttttactggagaggttagccct
gtgatgttgaaagatctaggtgtaacacatgttgtacttggacactcagaaagaagagag
ctatttgctgaaacgaacgaattagtaaataagaaaacgaaagcagcatttgctcatgat
ttaactccgattgtttgtgtaggagaaacactggatcaacgtgaagcaaacgaaacgatg
aacattgttggcgaacaagtaaagcaagcagttgctggtcttaccaatgaacaagttgct
gaaactattattgcctatgaaccagtatgggcaatcggtacaggaaaaacagctacaagt
gaacaagcaaatgaagtttgcactgaaattcgcaaagtggtagctgaagttacgtcagca
gatgtggctgaaaaagtaattattcaatatggcggtagtgtaaaacctgccaatgtggat
gagttattagctcaatctgatattgacggagcattagttggtggggcaagtctcgatcct
gaatcattcctacaactagtggaggcaggtacaaaatga

DBGET integrated database retrieval system