KEGG   Oceanobacillus iheyensis: OB2436Help
Entry
OB2436            CDS       T00093                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00010  Glycolysis / Gluconeogenesis
oih00051  Fructose and mannose metabolism
oih00562  Inositol phosphate metabolism
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
oih01230  Biosynthesis of amino acids
Module
oih_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oih_M00002  Glycolysis, core module involving three-carbon compounds
oih_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2436 (tpi)
   00051 Fructose and mannose metabolism
    OB2436 (tpi)
   00562 Inositol phosphate metabolism
    OB2436 (tpi)
Enzymes [BR:oih01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OB2436 (tpi)
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OB2436 (tpi)
  Exosomal proteins of bladder cancer cells
   OB2436 (tpi)
  Exosomal proteins of melanoma cells
   OB2436 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAC14392
JAMSTEC: OB2436
UniProt: Q8ENP4
Position
complement(2491393..2492151)
Genome map
AA seq 252 aa AA seqDB search
MRKKVIAGNWKMNKVLSEAGEFMNSVVPKAPKGNDVEAIVCAPFPFLSKLVEQAKGSEVK
VAAQNMHFEDSGAFTGEVSPVMLKDLGVTHVVLGHSERRELFAETNELVNKKTKAAFAHD
LTPIVCVGETLDQREANETMNIVGEQVKQAVAGLTNEQVAETIIAYEPVWAIGTGKTATS
EQANEVCTEIRKVVAEVTSADVAEKVIIQYGGSVKPANVDELLAQSDIDGALVGGASLDP
ESFLQLVEAGTK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaagtgatagctggtaactggaaaatgaataaagtactatctgaagcagga
gaatttatgaattctgtagtaccaaaagctccgaaaggaaatgacgtagaagcaattgtg
tgtgctccattccctttcctgtcaaaattagttgagcaagcgaagggatcagaagtaaaa
gtagcagcgcaaaacatgcattttgaagattctggtgcttttactggagaggttagccct
gtgatgttgaaagatctaggtgtaacacatgttgtacttggacactcagaaagaagagag
ctatttgctgaaacgaacgaattagtaaataagaaaacgaaagcagcatttgctcatgat
ttaactccgattgtttgtgtaggagaaacactggatcaacgtgaagcaaacgaaacgatg
aacattgttggcgaacaagtaaagcaagcagttgctggtcttaccaatgaacaagttgct
gaaactattattgcctatgaaccagtatgggcaatcggtacaggaaaaacagctacaagt
gaacaagcaaatgaagtttgcactgaaattcgcaaagtggtagctgaagttacgtcagca
gatgtggctgaaaaagtaattattcaatatggcggtagtgtaaaacctgccaatgtggat
gagttattagctcaatctgatattgacggagcattagttggtggggcaagtctcgatcct
gaatcattcctacaactagtggaggcaggtacaaaatga

DBGET integrated database retrieval system