KEGG   Oceanobacillus iheyensis: OB2551Help
Entry
OB2551            CDS       T00093                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oih  Oceanobacillus iheyensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OB2551
Enzymes [BR:oih01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     OB2551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2605469..2606431)
Genome map
AA seq 320 aa AA seqDB search
MAKNYIYGNTPCFLDGEKVSLQDNSYKNKDVLIYGVPWEGAVTWGDYTGCELGPKAIRLN
SERYSGYLPELNDIDVLQHYSFGDLGDVDVVPADSPETMRRIEQFAKEVWKTGKFPIAFG
GDHGITYPIVQALSNEVEGKVGIIHLDAHYDNHPDYHGDLYARSTPFHRIYESESVRNQS
IVHMGIHGPRNKPETGKYANEVGATTISVREIKQANNQLHDLAKKAYEIASEGTEAVYLS
ICSDVLDFAFNPGGPVDGNGLTSYELLELILEFSQMGINGMDYVEVYPQQDANDNSSHFV
TYAVLYALAGKLIHDKKENL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaattatatttatggtaatactccatgttttttagacggagaaaaagtatcc
ttgcaagataactcctataagaataaggatgttcttatttacggtgttccatgggaaggg
gcagttacatggggagattatactgggtgtgaattaggccccaaagcaattagattaaat
tcagagcgatattccggttatttaccagaactaaatgatatcgatgtattacagcactac
tcattcggggatttgggtgatgtagatgtggtacctgcagattctcctgaaacaatgcgg
agaattgagcaatttgctaaggaagtttggaagacagggaaattccctattgcatttggc
ggtgaccatggtattacgtatccaattgtacaagcattaagtaatgaagtagaagggaaa
gtaggtattattcatctagatgcacattatgataatcatccggattatcatggtgatctt
tatgcaagaagtacaccttttcatcgcatttatgagagtgaaagcgttcgtaatcaaagt
attgttcatatgggaatacatggcccacgaaataaaccagaaacaggaaagtatgcaaat
gaagtaggagcaactaccatttcagttcgtgaaattaaacaagcgaacaatcagctgcat
gatctggcaaaaaaagcatatgaaattgcaagtgaaggtacagaagctgtttacttaagt
atttgtagtgatgtcttggatttcgcattcaaccctggtggaccagtagatggtaatgga
ttaacttcatatgagttgttggaacttattctggaattttcccagatggggataaatgga
atggattatgtagaagtctatccacaacaagatgctaacgataactcatctcattttgtt
acttatgctgttttatatgcattagctggtaagttaattcatgataaaaaagaaaaccta
taa

DBGET integrated database retrieval system