KEGG   Oceanobacillus iheyensis: OB2736Help
Entry
OB2736            CDS       T00093                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
oih  Oceanobacillus iheyensis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OB2736
   00562 Inositol phosphate metabolism
    OB2736
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OB2736
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OB2736
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     OB2736
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     OB2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JAMSTEC: 
UniProt: 
Position
complement(2805519..2806979)
Genome map
AA seq 486 aa AA seqDB search
MTQTTVKNVKNYIGGEWIESRTEKTEDVFNPATGEVIAQVPISTTEDVHHAIEVANEAFK
TWKEVPVPKRARILFKYQQLLVEHWEELAKLITLENGKNYAEAYGEVQRGIENVEFATGA
PSLMMGEQLASIATELESGVYRYPIGVIGGITPFNFPMMVPCWMFPMAIATGNTFVMKPS
ERTPLLANRLAELLEEAGLPNGVFNIVHGAHDVVNGLLDHKKVAAISFVGSQPVAEYVYK
RGTQNLKRVQALAGAKNHSIVLSDANLENATTQILNAAFGSAGERCMAASVVAVEEDVAD
EFVTLLTQKANEIKIGNGLDEGVFLGPVIRDQHKERTLQYIESGEEEGANLVRDGRTDEA
AKQEGYFVGPTIFDHVTSEMKIWQDEIFAPVLSIARVNNLEEGVDLANESRFANGACIFT
RDGGSVRRFRETIDAGMLGVNIGVPAPMAFLPFSGWKDSFYGDLHANGKDGLQFYTRKKV
LTTKWV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaactacagtaaaaaatgtaaaaaactatatcggtggagaatggattgaatca
cgtacggaaaaaacagaggatgtctttaatccagctacaggagaagtaattgcacaagta
ccaatttcaacaactgaagatgtgcatcatgcgatagaggtagcaaatgaagcatttaag
acttggaaggaagttcctgttccaaaacgggcgcgaattttgtttaaatatcaacaatta
ctggtggaacattgggaagagttagcgaagttaattacattggaaaatggaaaaaattac
gccgaagcttatggagaagtacaacgtggaattgagaatgtagaatttgcgactggtgca
ccatcattaatgatgggagaacagctcgcttctattgcaacggaattagaatctggtgta
tatcgttatccgataggagtgattggtggaattacaccgtttaattttccgatgatggta
ccgtgctggatgttcccgatggcaattgctactggaaatacgtttgtaatgaaaccttct
gaacgtacaccattattagcaaatcggttggcagaactattagaagaagcaggtcttcca
aacggggtattcaatattgtacatggtgctcatgatgtcgtaaatgggttacttgatcat
aaaaaagttgctgctatttcttttgttggttctcagccagtagctgaatacgtatataaa
cgaggaacacagaatttgaaacgtgtacaggcacttgcaggagcaaaaaatcactcgatc
gtactaagtgatgccaaccttgaaaatgccactactcaaatattaaatgctgcattcggt
tctgcaggcgaaagatgtatggctgcatcagttgtagcagttgaagaagatgttgcagat
gaatttgttactttattaacgcagaaagcgaatgaaataaaaattggaaatgggttagat
gaaggggtattccttggaccggtaatccgtgaccaacataaggaacggacgttgcagtat
attgaatcaggggaagaagaaggtgcaaatcttgttcgcgatggtcgtacagacgaagca
gccaaacaagaaggttattttgtcggaccaacgatctttgatcatgtaacgtcagagatg
aaaatttggcaagatgaaatttttgcaccagtgttgtcgattgcccgtgtgaataattta
gaggaaggtgtcgatttagcaaatgaatctcggtttgcaaatggggcatgtatctttaca
agagatgggggaagcgtgcgtagatttagagagactatcgatgctggcatgcttggtgta
aatattggtgttcctgcaccaatggcattcttaccattctctggttggaaagattcattc
tatggggatttacatgcaaacggaaaagatggattacaattttatacacgtaaaaaagta
cttactaccaaatgggtgtag

DBGET integrated database retrieval system