KEGG   Oceanobacillus iheyensis: OB2736Help
Entry
OB2736            CDS       T00093                                 

Definition
methylmalonate-semialdehyde dehydrogenase (EC:1.2.1.27)
Orthology
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
oih  Oceanobacillus iheyensis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:oih01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:oih00640]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:oih00562]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:oih00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:oih00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2805519..2806979)
Genome map
AA seq 486 aa AA seqDB search
MTQTTVKNVKNYIGGEWIESRTEKTEDVFNPATGEVIAQVPISTTEDVHHAIEVANEAFK
TWKEVPVPKRARILFKYQQLLVEHWEELAKLITLENGKNYAEAYGEVQRGIENVEFATGA
PSLMMGEQLASIATELESGVYRYPIGVIGGITPFNFPMMVPCWMFPMAIATGNTFVMKPS
ERTPLLANRLAELLEEAGLPNGVFNIVHGAHDVVNGLLDHKKVAAISFVGSQPVAEYVYK
RGTQNLKRVQALAGAKNHSIVLSDANLENATTQILNAAFGSAGERCMAASVVAVEEDVAD
EFVTLLTQKANEIKIGNGLDEGVFLGPVIRDQHKERTLQYIESGEEEGANLVRDGRTDEA
AKQEGYFVGPTIFDHVTSEMKIWQDEIFAPVLSIARVNNLEEGVDLANESRFANGACIFT
RDGGSVRRFRETIDAGMLGVNIGVPAPMAFLPFSGWKDSFYGDLHANGKDGLQFYTRKKV
LTTKWV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaactacagtaaaaaatgtaaaaaactatatcggtggagaatggattgaatca
cgtacggaaaaaacagaggatgtctttaatccagctacaggagaagtaattgcacaagta
ccaatttcaacaactgaagatgtgcatcatgcgatagaggtagcaaatgaagcatttaag
acttggaaggaagttcctgttccaaaacgggcgcgaattttgtttaaatatcaacaatta
ctggtggaacattgggaagagttagcgaagttaattacattggaaaatggaaaaaattac
gccgaagcttatggagaagtacaacgtggaattgagaatgtagaatttgcgactggtgca
ccatcattaatgatgggagaacagctcgcttctattgcaacggaattagaatctggtgta
tatcgttatccgataggagtgattggtggaattacaccgtttaattttccgatgatggta
ccgtgctggatgttcccgatggcaattgctactggaaatacgtttgtaatgaaaccttct
gaacgtacaccattattagcaaatcggttggcagaactattagaagaagcaggtcttcca
aacggggtattcaatattgtacatggtgctcatgatgtcgtaaatgggttacttgatcat
aaaaaagttgctgctatttcttttgttggttctcagccagtagctgaatacgtatataaa
cgaggaacacagaatttgaaacgtgtacaggcacttgcaggagcaaaaaatcactcgatc
gtactaagtgatgccaaccttgaaaatgccactactcaaatattaaatgctgcattcggt
tctgcaggcgaaagatgtatggctgcatcagttgtagcagttgaagaagatgttgcagat
gaatttgttactttattaacgcagaaagcgaatgaaataaaaattggaaatgggttagat
gaaggggtattccttggaccggtaatccgtgaccaacataaggaacggacgttgcagtat
attgaatcaggggaagaagaaggtgcaaatcttgttcgcgatggtcgtacagacgaagca
gccaaacaagaaggttattttgtcggaccaacgatctttgatcatgtaacgtcagagatg
aaaatttggcaagatgaaatttttgcaccagtgttgtcgattgcccgtgtgaataattta
gaggaaggtgtcgatttagcaaatgaatctcggtttgcaaatggggcatgtatctttaca
agagatgggggaagcgtgcgtagatttagagagactatcgatgctggcatgcttggtgta
aatattggtgttcctgcaccaatggcattcttaccattctctggttggaaagattcattc
tatggggatttacatgcaaacggaaaagatggattacaattttatacacgtaaaaaagta
cttactaccaaatgggtgtag

DBGET integrated database retrieval system