KEGG   Oceanobacillus iheyensis: OB2736Help
Entry
OB2736            CDS       T00093                                 

Definition
methylmalonate-semialdehyde dehydrogenase (EC:1.2.1.27)
Orthology
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
oih  Oceanobacillus iheyensis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OB2736
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OB2736
   00562 Inositol phosphate metabolism
    OB2736
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OB2736
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OB2736
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     OB2736
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     OB2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2805519..2806979)
Genome map
AA seq 486 aa AA seqDB search
MTQTTVKNVKNYIGGEWIESRTEKTEDVFNPATGEVIAQVPISTTEDVHHAIEVANEAFK
TWKEVPVPKRARILFKYQQLLVEHWEELAKLITLENGKNYAEAYGEVQRGIENVEFATGA
PSLMMGEQLASIATELESGVYRYPIGVIGGITPFNFPMMVPCWMFPMAIATGNTFVMKPS
ERTPLLANRLAELLEEAGLPNGVFNIVHGAHDVVNGLLDHKKVAAISFVGSQPVAEYVYK
RGTQNLKRVQALAGAKNHSIVLSDANLENATTQILNAAFGSAGERCMAASVVAVEEDVAD
EFVTLLTQKANEIKIGNGLDEGVFLGPVIRDQHKERTLQYIESGEEEGANLVRDGRTDEA
AKQEGYFVGPTIFDHVTSEMKIWQDEIFAPVLSIARVNNLEEGVDLANESRFANGACIFT
RDGGSVRRFRETIDAGMLGVNIGVPAPMAFLPFSGWKDSFYGDLHANGKDGLQFYTRKKV
LTTKWV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaactacagtaaaaaatgtaaaaaactatatcggtggagaatggattgaatca
cgtacggaaaaaacagaggatgtctttaatccagctacaggagaagtaattgcacaagta
ccaatttcaacaactgaagatgtgcatcatgcgatagaggtagcaaatgaagcatttaag
acttggaaggaagttcctgttccaaaacgggcgcgaattttgtttaaatatcaacaatta
ctggtggaacattgggaagagttagcgaagttaattacattggaaaatggaaaaaattac
gccgaagcttatggagaagtacaacgtggaattgagaatgtagaatttgcgactggtgca
ccatcattaatgatgggagaacagctcgcttctattgcaacggaattagaatctggtgta
tatcgttatccgataggagtgattggtggaattacaccgtttaattttccgatgatggta
ccgtgctggatgttcccgatggcaattgctactggaaatacgtttgtaatgaaaccttct
gaacgtacaccattattagcaaatcggttggcagaactattagaagaagcaggtcttcca
aacggggtattcaatattgtacatggtgctcatgatgtcgtaaatgggttacttgatcat
aaaaaagttgctgctatttcttttgttggttctcagccagtagctgaatacgtatataaa
cgaggaacacagaatttgaaacgtgtacaggcacttgcaggagcaaaaaatcactcgatc
gtactaagtgatgccaaccttgaaaatgccactactcaaatattaaatgctgcattcggt
tctgcaggcgaaagatgtatggctgcatcagttgtagcagttgaagaagatgttgcagat
gaatttgttactttattaacgcagaaagcgaatgaaataaaaattggaaatgggttagat
gaaggggtattccttggaccggtaatccgtgaccaacataaggaacggacgttgcagtat
attgaatcaggggaagaagaaggtgcaaatcttgttcgcgatggtcgtacagacgaagca
gccaaacaagaaggttattttgtcggaccaacgatctttgatcatgtaacgtcagagatg
aaaatttggcaagatgaaatttttgcaccagtgttgtcgattgcccgtgtgaataattta
gaggaaggtgtcgatttagcaaatgaatctcggtttgcaaatggggcatgtatctttaca
agagatgggggaagcgtgcgtagatttagagagactatcgatgctggcatgcttggtgta
aatattggtgttcctgcaccaatggcattcttaccattctctggttggaaagattcattc
tatggggatttacatgcaaacggaaaagatggattacaattttatacacgtaaaaaagta
cttactaccaaatgggtgtag

DBGET integrated database retrieval system