KEGG   Oceanobacillus iheyensis: OB2763Help
Entry
OB2763            CDS       T00093                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
oih  Oceanobacillus iheyensis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2763
Enzymes [BR:oih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     OB2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
2833502..2834899
Genome map
AA seq 465 aa AA seqDB search
MTEQNYQFPAGFWWGSATSATQIEGAANQYGKGQNIWDHWYNIQPERFYNQVGPEHTSDF
YHRYKEDIALMKEFGHNSFRLSISWSRLIPDGVGEVNEEAVSFYHNVIDELIANDIEPFV
NLFHFDMPLPLQEIGGWENREVIEMYRQYAKKAFELFGDKVKKWFTFNEPIVPVEGGYLY
NFHYPNVVDAKRAIQVAYHTIIAHATAVQTFKELNIENGKIGIILNLTPSYPRSENTADQ
KAAHIADLFFNRSFLDPAVLGEYPEDLINLLKEHNHLPQTEDGDAGLIKENTIDILGVNY
YQPRRVKAKDNLPNPYSPFMPDWFFDSYEMPGRRMNEYRGWEIYEKGVYDIMINLKENYH
NIESFISENGMGVQGEEHFIENGQIQDDYRITFIKDHLKWLHRAIDEGCNAKGYHLWTTM
DNWSWSNAYKNRYGFFSVNIDTMERTPKKSAYWFKQISEQNGFHA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaaaactatcaatttcctgctggattctggtggggcagtgcaacttctgca
acacagattgaaggtgcagcaaatcaatatggaaaaggacaaaatatatgggatcactgg
tataacatacaacctgaacgattttataatcaagttggtccagagcatacttctgacttt
taccatcgctataaagaagacattgccttaatgaaagaattcggacataattcattccgt
ctttctatatcttggtcgaggctaattccagatggagtaggtgaagtaaatgaagaggct
gtatcgttctatcataatgttattgatgaattaatcgccaatgatatcgaaccttttgtc
aatctgtttcattttgatatgccgctcccattgcaagaaattggtggctgggaaaatcgt
gaagttatagaaatgtatcgtcaatatgcgaaaaaagcattcgaattatttggagataaa
gtaaaaaaatggtttacatttaacgaaccaatcgtaccagttgaaggtggatacctatat
aacttccattacccaaatgttgtagatgcaaaaagagcaatacaagttgcttaccatacc
attatagctcatgcaactgccgttcagacttttaaagaattgaatattgaaaatggaaaa
attggtattatcttaaacttaacaccatcttatccaagaagtgaaaacacagctgatcaa
aaagctgcgcatatcgctgatctattctttaatcgcagtttcttagatcctgctgtacta
ggagagtacccagaagatttaattaaccttttaaaagaacataatcaccttccacaaaca
gaggatggagatgcaggattaatcaaggaaaacacgattgatattttaggggtgaattac
tatcaacctagaagagtaaaggcaaaagataatttgccaaatccgtacagtccttttatg
cctgactggttctttgattcatatgaaatgccaggaagacgcatgaatgaatatcgagga
tgggaaatctatgaaaaaggtgtctatgatattatgattaatctaaaagaaaactaccat
aatatcgaatcatttatttcagaaaatggtatgggtgttcaaggcgaagaacattttatc
gagaatggacaaattcaagatgattaccgaatcacctttatcaaagatcacttgaaatgg
ctacaccgagcgattgatgagggttgtaatgcgaaaggctatcacctttggacaacaatg
gataactggtcatggtcaaacgcttataaaaatcgctacggattcttttctgtaaatatt
gacacaatggaacgaactccgaagaaaagtgcctattggtttaaacaaataagtgaacaa
aatggatttcacgcatag

DBGET integrated database retrieval system