KEGG   Oceanobacillus iheyensis: OB2801Help
Entry
OB2801            CDS       T00093                                 

Definition
(GenBank) alcohol dehydrogenase (zinc-containing)
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00010  Glycolysis / Gluconeogenesis
oih00071  Fatty acid degradation
oih00350  Tyrosine metabolism
oih00625  Chloroalkane and chloroalkene degradation
oih00626  Naphthalene degradation
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2801
  Lipid metabolism
   00071 Fatty acid degradation
    OB2801
  Amino acid metabolism
   00350 Tyrosine metabolism
    OB2801
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OB2801
   00626 Naphthalene degradation
    OB2801
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OB2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N ADH_zinc_N_2 NADH_4Fe-4S F420_oxidored Urocanase
Motif
Other DBs
NCBI-ProteinID: BAC14757
JAMSTEC: OB2801
UniProt: Q8CX91
Position
complement(2881784..2882908)
Genome map
AA seq 374 aa AA seqDB search
MQVKTAVLRTQGADSPYKESKPIKIETLELDAPQLGEVLIQIKAASLCHSDLSVINGSRP
RPLPMALGHEASGVVVEVGEGVTYLEPGDHIVCVFVPSCGHCVPCKEGRPALCEPGADSN
TAGTLISGGIRLHADGEAINHHLGVSAFSEFAVVSRNSLVKVKKDIPFEKLALFGCAVIT
GVGAVVNTANVKLGSTVAIVGLGGIGLSALLGAVAAGASRIIAVDINENKLKQAKELGAT
DVFNSTEETVIQQIKEATDGGVNYAFETAGAVPAMEVAYGITKRGGTTVTTGLPHPEHQF
SFPYVTLTAEEKTLKGSYVGSCVPDRDIPRYMNLFKQDRLPVDKLMTDFISLDEINEGFD
KLAKGDSSRIIIKM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgaaaacagctgttttacgtactcaaggagcagattcaccgtacaaggaaagt
aaacctattaaaatagagacgttagaattggatgctcctcagcttggtgaagtattaatt
caaataaaagctgcaagtctctgtcattcagacttatccgttattaatggaagtcgacca
agacctcttccaatggctcttgggcatgaggcatccggtgtggttgttgaagttggagaa
ggggttacatatttagagccaggagatcatattgtatgtgtgtttgtaccaagttgtgga
cattgtgtaccttgtaaagaaggtcgtccggcattatgcgaaccaggtgcagactcgaat
actgctggaacattaattagtggtggcatccgattacatgctgatggtgaagcgattaat
catcatcttggtgtatctgcgttttcagaatttgcagtggtatctagaaattccttagta
aaggtaaaaaaggatattccatttgaaaaactcgcattatttggttgtgcagtaataacc
ggagtgggagcagttgtgaatacagccaatgtgaagcttggtagtacagttgcaattgtt
gggctaggtggaatcggactcagtgctttactgggtgcagtagctgcaggtgcctccaga
ataatagcggtagatatcaatgaaaacaaacttaaacaagcaaaagaactaggagctacc
gatgtctttaattctacagaagaaacagttatccaacaaattaaagaagcaaccgatggc
ggtgtaaactatgcatttgaaacagccggtgctgtcccagcaatggaagtcgcttatggc
attacaaagcgtggcggaactacagtgaccactggtttaccacatccagaacatcaattt
tcatttccatatgtgacattaactgctgaggagaagacactaaaaggctcgtatgttggt
agttgcgtacctgaccgtgatattccaagatacatgaatttatttaaacaagatcgtcta
cctgtagataaattgatgacagattttatttctctagatgaaataaacgaagggtttgat
aagttagcaaaaggggattcgtcgagaattattattaaaatgtag

DBGET integrated database retrieval system