KEGG   Oceanobacillus iheyensis: OB2801Help
Entry
OB2801            CDS       T00093                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OB2801
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB2801
  Lipid metabolism
   00071 Fatty acid degradation
    OB2801
  Amino acid metabolism
   00350 Tyrosine metabolism
    OB2801
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OB2801
   00626 Naphthalene degradation
    OB2801
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OB2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2881784..2882908)
Genome map
AA seq 374 aa AA seqDB search
MQVKTAVLRTQGADSPYKESKPIKIETLELDAPQLGEVLIQIKAASLCHSDLSVINGSRP
RPLPMALGHEASGVVVEVGEGVTYLEPGDHIVCVFVPSCGHCVPCKEGRPALCEPGADSN
TAGTLISGGIRLHADGEAINHHLGVSAFSEFAVVSRNSLVKVKKDIPFEKLALFGCAVIT
GVGAVVNTANVKLGSTVAIVGLGGIGLSALLGAVAAGASRIIAVDINENKLKQAKELGAT
DVFNSTEETVIQQIKEATDGGVNYAFETAGAVPAMEVAYGITKRGGTTVTTGLPHPEHQF
SFPYVTLTAEEKTLKGSYVGSCVPDRDIPRYMNLFKQDRLPVDKLMTDFISLDEINEGFD
KLAKGDSSRIIIKM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgaaaacagctgttttacgtactcaaggagcagattcaccgtacaaggaaagt
aaacctattaaaatagagacgttagaattggatgctcctcagcttggtgaagtattaatt
caaataaaagctgcaagtctctgtcattcagacttatccgttattaatggaagtcgacca
agacctcttccaatggctcttgggcatgaggcatccggtgtggttgttgaagttggagaa
ggggttacatatttagagccaggagatcatattgtatgtgtgtttgtaccaagttgtgga
cattgtgtaccttgtaaagaaggtcgtccggcattatgcgaaccaggtgcagactcgaat
actgctggaacattaattagtggtggcatccgattacatgctgatggtgaagcgattaat
catcatcttggtgtatctgcgttttcagaatttgcagtggtatctagaaattccttagta
aaggtaaaaaaggatattccatttgaaaaactcgcattatttggttgtgcagtaataacc
ggagtgggagcagttgtgaatacagccaatgtgaagcttggtagtacagttgcaattgtt
gggctaggtggaatcggactcagtgctttactgggtgcagtagctgcaggtgcctccaga
ataatagcggtagatatcaatgaaaacaaacttaaacaagcaaaagaactaggagctacc
gatgtctttaattctacagaagaaacagttatccaacaaattaaagaagcaaccgatggc
ggtgtaaactatgcatttgaaacagccggtgctgtcccagcaatggaagtcgcttatggc
attacaaagcgtggcggaactacagtgaccactggtttaccacatccagaacatcaattt
tcatttccatatgtgacattaactgctgaggagaagacactaaaaggctcgtatgttggt
agttgcgtacctgaccgtgatattccaagatacatgaatttatttaaacaagatcgtcta
cctgtagataaattgatgacagattttatttctctagatgaaataaacgaagggtttgat
aagttagcaaaaggggattcgtcgagaattattattaaaatgtag

DBGET integrated database retrieval system