KEGG   Oceanobacillus iheyensis: OB2894Help
Entry
OB2894            CDS       T00093                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00040  Pentose and glucuronate interconversions
oih00052  Galactose metabolism
oih00500  Starch and sucrose metabolism
oih00520  Amino sugar and nucleotide sugar metabolism
oih01100  Metabolic pathways
oih01130  Biosynthesis of antibiotics
Module
oih_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OB2894
   00052 Galactose metabolism
    OB2894
   00500 Starch and sucrose metabolism
    OB2894
   00520 Amino sugar and nucleotide sugar metabolism
    OB2894
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OB2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Glycos_transf_2 Smr PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: BAC14850
JAMSTEC: OB2894
UniProt: Q8EMF3
Position
complement(2981648..2982535)
Genome map
AA seq 295 aa AA seqDB search
MRTIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHNFELEDNLVKKEKFDLLDKVNHASSVDLHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVRADTPGLRQLIEQYEETQSSVVGVQQVPDTETHRYGIVDPSMIEGR
RYKVNHFVEKPAQGTAPSNLAIMGRYVFNPEIFQFLDKQQIGAGGEIQLTDAIQMLNEIQ
PVYAYDFLGKRYDVGEKLGFVKTTIDLALENAEIKDELFSYLEEKVTEKAIKTNY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagaactataaaaaaagcaattattcccgctgcggggctagggacgcgtttcttacct
gcaacaaaagcaatgccaaaagaaatgctgccaattgttgataaaccaacaattcaatac
attgttgaagaagcaattgaatctggtattgaagatattattatcgttacaggtaaagga
aagcgtgcaatcgaggatcatttcgatcataattttgaactagaagataatctagtaaag
aaagagaagtttgatttactagataaggttaatcacgcttctagtgtagaccttcactac
ataaggcaaaaagaaccaaaaggtttaggacatgctgtatggtgtgcgcgtaaatttatt
ggaaacgaaccctttgctgtcttgcttggggacgacatagtccgtgcagatacaccggga
cttcgacagttaatcgagcagtatgaagaaacgcaaagctcggttgttggtgtccaacag
gtacctgatacggaaacgcatcgttacggaattgtagatccaagtatgatcgaagggcgt
cgttataaggttaatcactttgtagaaaaaccagcccaaggaactgcaccttcaaatcta
gcaattatgggaagatacgtatttaatccagagattttccaattccttgacaagcaacaa
attggtgctggtggggagatccaactaacggatgcgattcagatgttgaatgagattcaa
ccagtatatgcctatgatttcctgggaaaacgatatgacgtaggagaaaaattaggtttt
gtgaaaactactattgatttagcattggaaaatgccgaaataaaagatgagttgtttagt
tatttggaagagaaagttacagaaaaagcgataaaaacgaattattag

DBGET integrated database retrieval system