KEGG   Oceanobacillus iheyensis: OB2894Help
Entry
OB2894            CDS       T00093                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oih  Oceanobacillus iheyensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OB2894
   00052 Galactose metabolism
    OB2894
   00500 Starch and sucrose metabolism
    OB2894
   00520 Amino sugar and nucleotide sugar metabolism
    OB2894
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OB2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(2981648..2982535)
Genome map
AA seq 295 aa AA seqDB search
MRTIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHNFELEDNLVKKEKFDLLDKVNHASSVDLHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVRADTPGLRQLIEQYEETQSSVVGVQQVPDTETHRYGIVDPSMIEGR
RYKVNHFVEKPAQGTAPSNLAIMGRYVFNPEIFQFLDKQQIGAGGEIQLTDAIQMLNEIQ
PVYAYDFLGKRYDVGEKLGFVKTTIDLALENAEIKDELFSYLEEKVTEKAIKTNY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagaactataaaaaaagcaattattcccgctgcggggctagggacgcgtttcttacct
gcaacaaaagcaatgccaaaagaaatgctgccaattgttgataaaccaacaattcaatac
attgttgaagaagcaattgaatctggtattgaagatattattatcgttacaggtaaagga
aagcgtgcaatcgaggatcatttcgatcataattttgaactagaagataatctagtaaag
aaagagaagtttgatttactagataaggttaatcacgcttctagtgtagaccttcactac
ataaggcaaaaagaaccaaaaggtttaggacatgctgtatggtgtgcgcgtaaatttatt
ggaaacgaaccctttgctgtcttgcttggggacgacatagtccgtgcagatacaccggga
cttcgacagttaatcgagcagtatgaagaaacgcaaagctcggttgttggtgtccaacag
gtacctgatacggaaacgcatcgttacggaattgtagatccaagtatgatcgaagggcgt
cgttataaggttaatcactttgtagaaaaaccagcccaaggaactgcaccttcaaatcta
gcaattatgggaagatacgtatttaatccagagattttccaattccttgacaagcaacaa
attggtgctggtggggagatccaactaacggatgcgattcagatgttgaatgagattcaa
ccagtatatgcctatgatttcctgggaaaacgatatgacgtaggagaaaaattaggtttt
gtgaaaactactattgatttagcattggaaaatgccgaaataaaagatgagttgtttagt
tatttggaagagaaagttacagaaaaagcgataaaaacgaattattag

DBGET integrated database retrieval system