KEGG   Oryzias latipes (Japanese medaka): 100049241Help
Entry
100049241         CDS       T02443                                 

Gene name
pc2, Pcsk2
Definition
proprotein convertase type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100049241 (pc2)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S8: subtilisin family
   100049241 (pc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 641 aa AA seqDB search
MHGSPRHGTAVGVLVLLNALLFATEAAEGVLTEHLLVQLHEDAQDEAHQLAAQHGFQSAR
KLPFGDGLFHFYPQDTSKRRSKRSARIKQWLQNNRRVKNVIEQEGFRRQKRGYRNINDIE
VNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLA
SNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGI
RMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK
RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPHK
IQSGNKLVLAINTEACEGKDNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSR
RPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFQGDQPQRGVLKEWTVMLHGTQSAP
YIDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSLLSKNN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcacggatctccccgtcatgggacagctgtgggggttctagtgcttttgaacgctctg
ctgtttgcaacggaggctgcagaaggagtcttgacggagcatcttttggtccagttgcac
gaggacgcacaggacgaggcgcaccaacttgcagcacaacatgggttccagagtgcaagg
aagctcccctttggagacggcctctttcacttctatcctcaggacacttcaaagaggcga
agcaaacgcagcgcccgtatcaaacaatggctccaaaataacagaagggtaaagaatgtc
atcgaacaagaaggtttccgtcgtcagaagcgaggctaccgaaatattaatgacatagaa
gtcaacatgagtgaccctctattcaccaagcagtggtatctgataaacaccggccaggcc
gatgggacccctgggctggatcttaatgtggctgaagcttggcagcttggttacacaggc
aagggagttactattgcaatcatggatgatggtattgactatctacatccagacttggca
tcaaattacaatgccgatgccagctatgacttcagcagcaatgacccatttccatttcca
cgttacacggatgactggttcaatagtcacggcactcggtgtgctggggaggtttctgca
gcagccaacaacaacatctgcggtgtgggagttgcttacaactccaaggtggcaggtatc
aggatgctggaccagcccttcatgacggatatcattgaagcatcatccatcagccacatg
cctcagacaattgatatttacagtgctagctggggcccaactgatgatggcaagacggtg
gatggacccagagagctgacattacaggcgatggctgatggggtcaacaaggggcgagga
gggaaaggcagcatctatgtttgggcttcaggggatggtggtagctatgacgactgcaac
tgcgatggttatgcctccagcatgtggaccatctccatcaactccgccatcaatgacggg
cggactgccctatacgatgagagctgctcttccacattggcatccacatttagtaatggg
cggaagaggaacccagaagctggtgttgcaacaacagacctgtatgggaactgcacactg
cgccactctggaacatcagcggcagctccagaggctgcaggcgtctttgctttggctctc
gaggctaaccccaacctgacatggagagatatgcagcacctgtctgtcctgacgtccaaa
cggaaccagctgcatgacgaagtccaccaatggaggaggaacggtgttgggctcgagttc
aaccacttgtttggctatggtgttctggacgcaggcggaatggtgaaaatggcaaaggag
tggaaaactgtaccggaacgctttcactgtgtagctggatccattcaggaaccccataaa
atccagtctggcaacaaactggttttggcgatcaacacagaagcctgtgaggggaaggac
aattttgtccgctacctggagcacgttcaggccgtggtgacggtcaacgccacccgccga
ggagacctcaacatcaacatgacctctcccatgggcacaaagtccctactgttgagccgc
agaccccgcgatgacgactccaaggtgggcttcgacaagtggcccttcatgaccacccac
acctggggggaggaccctcgtgggacgtgggtcctggaggtcggctttcagggtgaccag
ccacagcgaggggtcctgaaagagtggactgtcatgctgcacggaacacaaagtgcccct
tatatagaccagattgtgcgtgattatcagtccaaacttgccatgtccaagaaagaggag
ctagaggaggagctggatgaggctgtggagagaagcctgaaaagtctgctgagtaaaaac
aactaa

DBGET integrated database retrieval system