KEGG   Oryzias latipes (Japanese medaka): 100049381Help
Entry
100049381         CDS       T02443                                 

Gene name
st6gal2, siat2
Definition
(RefSeq) ST6 beta-galactosamide alpha-2,6-sialyltranferase 2 (EC:2.4.99.1)
  KO
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100049381 (st6gal2)
   00514 Other types of O-glycan biosynthesis
    100049381 (st6gal2)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100049381 (st6gal2)
Glycosyltransferases [BR:ola01003]
 Terminal extension
  Sialyltransferase
   100049381 (st6gal2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 509 aa AA seqDB search
MRFSMRQWRKLVLAAILAWALLFLGLLSYFLDNRVEEPLTPAGSLVSQHSDTRRLTSIQS
SQQQQQPVPGLRSEQGLNSIRTSHGNQPEAGVLSSSETPGNMVNHIPSSSPYQTYGSQEA
NHQNDLDPQSLAAWSSFGTQNVDSNFNIASQHRERASQSIFSNNVEDEELPNEISPLVER
RADADNVVQHMWRGTVSSGMLSPRLKRAMNDYINANKHHVSYQRHRKVARSAKELLCQMK
NQSQLRTVDGSEQPFSSLGWADFVPLVPLQRWNKQRGGRSFRTCAVVSSAGAILHSGLGK
EIDSHDAVLRFNAAPTEGYEQDVGTKTTIRIINSQILANPKHEFKTSSIYKNITLVAWDP
APYTLNLDEWFASPDYDLFGPYVEHRKNHAEQLFYILHPSYLWQLWDLIQSNTQEKIQPN
PPSSGFIGILTMMALCDKLHVYEYIPSMRQTDLCHYHENYYDAACTLGAYHPLIYEKNLI
RRINLGSEKDLLKKGRVTLPGFSTLTCGA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcagcatgaggcagtggaggaagctggtgctggcggccatactggcctgggcc
ctccttttccttggccttctctcctactttctggacaaccgtgtggaggagcctctgact
cctgccggctccttggtttcccagcattcagacactcggcggctcacctccatacagtcc
tcccagcagcagcagcagcccgtcccgggtctccgatctgagcagggtctgaactcaatc
agaacttctcatggaaaccagccggaagcaggagttttgtccagctctgaaaccccaggg
aacatggtgaaccacattccaagcagttctccctatcaaacttatggaagccaggaagca
aaccatcagaatgatttggacccgcagagtctggctgcctggtcctccttcggtacacaa
aacgtagattcaaacttcaatattgcatcacagcatcgtgagagagcatctcaaagcatc
ttcagcaacaacgttgaagatgaagagctgccaaacgaaataagtcctttagttgagagg
agggccgatgcagacaatgtggtgcagcacatgtggaggggcaccgtgtcctctggcatg
ctgagtcctcgactgaagcgagccatgaatgactacataaacgccaacaaacaccacgtt
tcctaccaaaggcaccgcaaggtcgctcgcagcgcaaaggagctgctgtgccaaatgaaa
aaccagtcccagctgaggacggtggacgggtccgaacagcctttctcctcgcttggctgg
gctgattttgtgccattggtcccccttcaacgttggaacaaacagcggggggggcgcagc
ttcaggacctgcgcggtggtcagctccgctggtgccatcctgcactcaggcctgggcaaa
gagattgacagccacgatgccgttctacgcttcaacgcagcgcccactgagggatacgag
caagacgtggggaccaaaaccaccattcgcatcatcaattcccagattttggcgaatccc
aagcatgagtttaagactagttccatctacaagaacataactctggtggcctgggatcct
gcaccctacacgctcaatttagacgagtggtttgccagtccggactacgacctgttcggt
ccgtatgtggagcaccgcaagaaccatgctgagcagctcttctacatcctacaccccagc
tacctgtggcaactgtgggatctgattcagagcaacactcaggagaaaatccagcccaac
cctccttcatctggcttcataggtatcttgaccatgatggccctatgcgacaagctgcac
gtgtacgagtacatcccctccatgaggcagacggacttgtgccactaccacgagaactat
tacgatgccgcctgcacgctgggcgcttaccaccccctcatttatgaaaagaacctgatc
cgccggataaacttgggctcggaaaaggacctcctaaaaaaggggcgggtcactctccca
ggcttcagcaccctcacctgtggcgcctga

DBGET integrated database retrieval system