KEGG   Oryzias latipes (Japanese medaka): 100049427Help
Entry
100049427         CDS       T02443                                 

Gene name
tyr, TYRO
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100049427 (tyr)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100049427 (tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100049427 (tyr)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100049427 (tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 540 aa AA seqDB search
MKSLFLSAVLLQFFETCWSQFPRPCANSEGLRTKECCPVWSGDGSPCGALSGRGFCADVS
VSDEPNGPQYPHSGIDDRERWPLAFFNRTCRCAGNYGGFNCGECRFGYWGSNCAEYRESV
RRNIMSMSTTEQQKFISYLNLAKNTINPDYVITTGTRAEMGENGESPMFSDINTYDLFVW
IHYYVSRDTFLGGPGNVWRDIDFAHESAAFLPWHRVYLLHWEQEIRKITGDFNFTIPYWD
WRDAQSCEVCTDNLMGGRNALNPNLISPASVFSSWKVICTQQEEYNNQEALCNATAEGPL
LRNPGNHDPNRVPRIPTTADVEFTISLPEYETGSMDRFANNSFRNVLEGFASPETGMAVQ
GQSTMHNALHVFMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRTHQPPRSIYPRTNAP
IGHNDGYYMVPFLPLYRNGDYLLSNKALGYEYAYLLDPGQRFVQEFLTPYLQQAQQIWQW
LLGAGILGALIATIVAAVIVFARRKRRRNQKRKRAPSFGERQPLLQSSSEEGSSSYQTTL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtctttttttgtctgccgttctgctgcagttctttgagacttgttggagccag
tttcctcgcccctgtgccaattcagagggactgcgaaccaaggagtgctgtccagtgtgg
agtggagatggctcaccctgtggggccctgtctggtcgcgggttctgtgcagacgtctcg
gtttcagacgagcccaacgggccgcagtaccctcacagcgggatcgatgacagggagcgc
tggcctttagctttcttcaaccggacgtgtcgttgtgcaggaaactatggagggtttaac
tgtggggaatgcagattcggttactggggctccaactgtgctgagtacagagagtcagtg
cgcaggaacatcatgagcatgtcaactactgagcagcaaaagttcatctcttatctaaac
ctggccaaaaacaccatcaacccagactacgtcatcaccacaggcacaagagcagagatg
ggagagaacggtgagagccccatgttctctgacatcaacacctacgacctatttgtctgg
atacactactacgtgtccagagacaccttcttgggagggcctgggaatgtttggagagat
atcgattttgcccacgagtctgctgcatttctcccctggcacagagtctacctgcttcac
tgggagcaggagatacgcaaaatcacaggagattttaactttaccatcccgtactgggac
tggagggatgcccagtcctgtgaagtctgcactgataatctgatgggtggacgtaacgcc
cttaatccaaaccttatcagccctgcttctgtcttctcctcatggaaggtaatctgcacc
cagcaagaagagtacaacaaccaagaggctttgtgtaacgctactgcagaaggtccactg
ttgcgtaaccccggcaaccatgatccaaaccgcgtgccacggatccctacgaccgctgac
gtagagttcaccatcagtcttccagagtatgagactgggtccatggaccgatttgccaac
aacagctttcgaaacgtcttagagggttttgccagcccagaaacaggcatggctgtgcaa
ggccagagcaccatgcacaatgcgctgcatgtcttcatgaacggctcaatgtcctcagtc
cagggctcagccaacgaccccatcttcctccttcaccatgctttcattgacagcatcttt
gagcgctggctaagaactcatcagcctccccggtccatctacccacgtaccaatgcacca
attggccacaatgacggctactacatggtgccattccttcctctttataggaatggagac
tacctcctgtccaacaaggctcttggatacgagtacgcctacctgttggacccaggtcag
aggtttgtccaggagttcttgaccccctaccttcagcaagcccagcagatctggcagtgg
ctcctgggggccgggatcctcggtgctttgatcgccacaattgttgccgcggtgattgtt
tttgccagaaggaagaggagacgtaaccagaagaggaaaagggcgcccagctttggagag
aggcagccactgttgcagagcagttcagaagagggttcatcgtcataccagactacactt
taa

DBGET integrated database retrieval system