KEGG   Oryzias latipes (Japanese medaka): 100125487Help
Entry
100125487         CDS       T02443                                 

Definition
beta-carotene 15,15'-monooxygenase 2
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100125487
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     100125487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 524 aa AA seqDB search
MQSFIAKNGNETPEPVKAQVKGSLPSWLQGTLLRNGPGLFSVGDSEYNHWFDGSSLIHSF
TFSNGEVSYRSKFLKSDTYKRNIKANRIVVSEFGTMVYPDPCKNIFARTATHLSNIVPNF
TDNNLINIIRYGNDYYASSEVNYINQIDPDTLETVGRVNYRNHIALNLATAHPHYDDEGN
TYNMGTAIIGLGRPKYIIFKVPAKATGKDQKKPALRQVQQICSIPFRSALFPGYFHSFGM
TENYIVFVEQPFKLDIVKLATAYFRGVNWGSCLKFDEKDTTLFHIIDRKTGKKISAHYYA
DALVVFHHINAYEENGHVVFDMITYKDSNLYNMFYLHNMKKDTNAFIQTNQDFSPPVGQR
FVLPLDVHKESPKGTNLVTLTDTSAEAVMQEDGSVYCKPDNIFVGMELPGINYKFNARKY
RYFYGSRLEWSPHPNKIAKVDIATRTHLEWYQENCYPSEPVFVASPGAVEEDDGVILSSV
VSSDPDITPFMLVLNAKTFEEIARASIPTTVHMDLHGLFIPDAV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgttcatcgcaaagaatggaaatgaaactccagagccggtgaaagctcaggtg
aaagggtccctgccttcctggctgcaggggaccctgctgaggaacggccccggccttttc
tctgtgggggactctgaatacaaccactggtttgatggatcgtcactcatccatagtttc
accttcagtaatggggaagtgagctacagaagcaagttccttaagagtgacacctacaag
aggaacatcaaggccaaccggatcgttgtgtcagaatttggaaccatggtctaccctgat
ccctgcaaaaacatatttgccaggacagccacacaccttagcaacattgtgccaaacttt
actgacaacaacttgatcaacatcattcgttatggaaacgactactacgcctcctctgaa
gtcaactacatcaaccagattgacccagacaccttggaaaccgttggtagggtcaactac
aggaaccacattgctctgaatttagcaacagcccatcctcactatgatgatgagggcaac
acatacaacatggggacggccattattggccttggacgaccaaaatacatcatcttcaaa
gttcccgctaaagccacagggaaagaccagaagaagcccgcgctgaggcaagttcagcag
atctgttcgattccttttcgctccgccttgttcccgggctatttccacagctttggcatg
actgaaaactacatcgtcttcgtggaacaaccctttaaactggacatcgtcaaactggca
acggcatatttcagaggggtcaactgggggagctgcctcaagtttgatgagaaagacact
accttgtttcacatcattgacagaaaaacagggaagaaaatatccgcccactactacgct
gacgctctagttgtcttccatcacatcaatgcctatgaggagaacggccacgtggtcttc
gatatgatcacctacaaggacagcaatctatacaacatgttctatcttcacaacatgaag
aaggacaccaatgccttcatccagacaaaccaggatttttctccaccagttggtcaaaga
ttcgtcttgcctctcgatgttcacaaggaatcccctaaaggaaccaatcttgtgactctg
accgacacatctgcagaggcggtgatgcaggaggatggatcagtctactgcaagcctgac
aacattttcgtaggtatggagttgcccggaatcaactacaaatttaacgctagaaagtac
agatacttttatggctccaggctggaatggtctccgcaccccaacaagatcgccaaggta
gacattgcgaccagaacccatcttgagtggtaccaggagaactgctacccttcagagccg
gtgtttgtcgcatcccctggagcagtagaggaggacgatggtgttattctgtcttctgtt
gtttcttctgatcctgacatcaccccattcatgctggtcctgaacgcaaaaacctttgaa
gaaatcgccagggcttctattcccaccactgtccacatggaccttcatggactcttcatt
cctgatgctgtttga

DBGET integrated database retrieval system