KEGG   Oryzias latipes (Japanese medaka): 100125517Help
Entry
100125517         CDS       T02443                                 

Definition
UDP glucuronosyltransferase 1 family polypeptide A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100125517
   00053 Ascorbate and aldarate metabolism
    100125517
   00500 Starch and sucrose metabolism
    100125517
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100125517
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100125517
   00860 Porphyrin and chlorophyll metabolism
    100125517
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100125517
   00982 Drug metabolism - cytochrome P450
    100125517
   00983 Drug metabolism - other enzymes
    100125517
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100125517
Glycosyltransferases [BR:ola01003]
 Others
  Hydrophobic molecule
   100125517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MGVRGWFPTAGLLAWLCCLSLGPVQGGKVLVMPVDGSHWLSMKILVKELSRRGHEVTVLV
PESSLLIKGSKDYKTEVHKVPFTQEELNGKFDKLRESVFVKTPEFTDMFVNVQRLVEFTT
LQVKGCESLLDSEDLMERLRGEGFDAMLTDPFLPCGSILAKMFSIPAVYFLRGLPCELDY
KANQCPSPPSFVPVFYSGSTDKMNFLQRVKNFFMYNVQSYVCTVLYQHFDDLVSRRIESG
MSYKDLLSHGAIWLFRYDFTFEWPRPLMPNMVLIGGINCAKKAPLPTDLQEFVDGSGDDG
FIVFTLGSMVSTMPAEKAKQFFDAFRQIPQRVLWRYTGELPEDMPKNVKVMSWLPQNDLL
AHPKIKVFITHGGTHGIYEGICNGVPMLMFPLFGDQGDNVHRLVARGVAEKLSMLDVTTE
TLLAALKKLIYDKSYKERMATLSSIHLDRPIEPLELATFWTEFVMRHKGATHLRVAAHDL
NWFQYHSLDVIGVLAIVVITVLWVTLKCCSFGVRKCCGRRSSKKKSE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcagagggtggtttcccacagcagggctgctggcttggctgtgctgcctcagt
ctggggcccgttcagggggggaaggtgctggtcatgcctgtggatggaagtcactggctc
agcatgaagattctggtgaaggagctcagtcgcagaggccatgaggtcacagttctggtg
cctgaaagcagcctgctgatcaaaggctcgaaggactacaagacggaggtccacaaagtt
cccttcacccaggaggaactgaatggaaagtttgacaaactcagggagtcggtgttcgtc
aagaccccagagtttacagatatgtttgtcaatgtgcagcgtttggtggagtttaccacc
ctgcaggtgaaaggttgtgagagtctgctggacagcgaggatctgatggagaggctgaga
ggagaaggattcgatgccatgctgaccgaccccttccttccctgcggctccatcctggct
aagatgttttccattccagctgtttattttctgcgcgggcttccatgtgagctggattac
aaggccaaccagtgtccctctccgccttcttttgttcccgtgttttactccgggagcaca
gacaaaatgaacttcctgcagagagtgaagaacttcttcatgtacaacgtgcagtcctac
gtctgcacggtgctttaccagcactttgacgatctggttagcaggcgcatcgaaagtggc
atgtcctacaaagatctcctgagccacggggcgatctggctcttcagatatgatttcact
tttgaatggcccagacccctcatgccaaacatggtgttgattggtggaatcaactgtgcc
aagaaagcccctctcccaaccgacctgcaggagtttgtggacggctcaggagacgacggc
ttcatcgtcttcacgctgggctcaatggtgtccacaatgcctgcggagaaggccaaacag
ttcttcgatgcattccgccagatcccccagagggttttgtggagatacacaggagagctg
cccgaagatatgcccaaaaatgttaaagttatgagttggctacctcagaatgacctttta
gcccatcccaaaatcaaagtcttcataactcatggaggcacccatggaatctatgagggc
atctgcaacggggtgcccatgttgatgtttcctcttttcggggaccagggggataacgtg
catcggttggtggctcgcggggttgcagagaagctcagcatgttggacgtgacgactgaa
actctactggctgcactgaagaaactcatttatgacaaaagctacaaagagcggatggcg
actctgtcctccatccacttagaccggcccattgagccgctggaactggcgactttctgg
accgagtttgtcatgagacacaaaggagccacacatctacgggtggctgcacatgacctg
aactggtttcagtaccacagcctggacgtcatcggcgtcctcgccatcgtcgtcatcacc
gtgctgtgggtgactctgaaatgctgctcgttcggcgttcgcaagtgttgtggacgccga
agctcaaagaagaagtctgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system