KEGG   Oryzias latipes (Japanese medaka): 100125823Help
Entry
100125823         CDS       T02443                                 

Gene name
ezh2, olezh2
Definition
enhancer of zeste homolog 2 (EC:2.1.1.43)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100125823 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 760 aa AA seqDB search
MGTGKRSDKGPACWKRRVKSEYMRLRQMKRFRRADEVKGMFNSNRQKIMERTDILNQEWK
TRRIQPIHIMTPVSSRGTRECTVDSGFPEFSRQVIPLKTLNAVASVPVMYSWSPLQQNFM
VEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALVQY
SDNEDDEEDEEQDYKVDKMDLCDGKDHTEDPCKDGHSNESRANSDGSKKFPSDKIFEAIS
SMFPDKGSLEELKEKYKELTEQQLPGALPPECTPNIDGPNARSVQREQSLHSFHTLFCRR
CFKYDCFLHPFHATPNTYKRKNLENLVESKPCGIDCYMYLVQDGMFREFPAGVVAERAKT
PSKRSVGRRRGRQPNSNSSSRPSTPTISSETKDADSDREDGKEDERDNDKDDEDKKDETT
SSSEGNSRCQTPVKMKLTGEAEAVEWSGAEASLFRVLIGTYYDNFLAIARLIGTKTCRQV
YEFRVKESAIIARAPAEDEDTPPRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHP
RQPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCL
TCGAADHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVSGDH
RIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggggacggggaaacgctcagacaagggtcctgcctgctggaagaggagggtaaagtct
gaatacatgaggcttcggcagatgaaacgctttagacgggcagacgaggtcaagggaatg
ttcaactcgaaccgccaaaaaatcatggagagaacggatattctgaaccaggagtggaag
accaggcggatccagcccattcacatcatgactcctgtcagctctcgagggactcgagag
tgcacagtggacagcggtttcccagagttctccagacaagtcatccccctgaagaccctg
aacgccgtggcttcggttcctgtcatgtactcgtggtcgccgctgcagcagaacttcatg
gtggaagatgagacggtgctgcataacattccttacatgggggatgagatcctggaccag
gacgggactttcattgaagagctcatcaaaaactacgatggcaaagtccatggtgacaga
gagtgtggcttcatcaacgatgagatctttgtggagctggttaacgctctggtgcagtac
agcgacaatgaggacgatgaagaggatgaggagcaggactacaaggtggacaagatggat
ttgtgtgacggcaaagaccacacagaggatccctgcaaagatggacatagtaacgagagc
cgagccaacagtgacggcagcaagaagtttccctcagacaagatttttgaagccatctcc
tccatgtttcctgacaaaggctccctggaggagctcaaagagaagtacaaagagctgaca
gagcagcagctgcccggcgctctgccgcccgaatgcacgcccaacatcgacgggccgaac
gctcgctccgtgcagcgcgaacagagcctgcactccttccacacactgttctgcagacgc
tgcttcaaatacgactgcttcctgcacccttttcatgcaactccaaacacatataagcgc
aagaacctggagaacctggtggagagtaagccctgcggcatcgactgctacatgtatctt
gttcaggacgggatgtttcgggagtttcctgctggtgttgttgcagagcgggccaagacg
ccgtccaaacgctctgtgggtcgtcgccgcggacggcagcccaacagcaacagcagctct
cgacccagcacccccaccatttcctcagaaaccaaagacgccgacagcgaccgcgaggac
ggcaaggaagacgagcgagacaacgataaggacgatgaagacaagaaggacgagaccacc
agcagctcagaggggaactcgcgctgccagactccggtgaagatgaagctgacgggtgaa
gcagaggcggtggagtggagcggcgctgaagcgtctctgttcagggttctcatcgggacg
tactacgataactttctcgccatcgcgcgcctcattggcaccaagacctgcagacaggtt
tatgagttcagggtcaaagagtcggccatcatcgctcgagcgcctgcagaagacgaggac
acgcccccgaggaagaagaagaggaaacacagactgtgggccacccactgcaggaagatc
cagctgaagaaagatggatcatccaatcacgtgtacaactaccagccatgtgaccaccct
cggcagccctgtgactcctcctgtccctgcgtcaccgcccagaacttctgtgagaagttc
tgtcagtgcagctctgagtgccagaaccgtttcccaggttgtcggtgcaaagcccagtgc
aataccaagcaatgcccgtgttacctggcagtgagggagtgcgacccggacctctgtctg
acctgcggcgctgcggaccactgggacagcaagaacgtgtcctgtaagaactgctccatc
cagagaggagccaagaagcacctgctgctcgccccctcagacgtggccggctggggcatc
ttcatcaaagagccggtgcagaagaacgagttcatctccgagtactgtggagagatcatc
tcgcaggacgaggcagaccgcagagggaaggtctacgacaaatacatgtgcagcttcctc
ttcaacctcaataacgatttcgtggttgatgccacaaggaaaggaaacaagatccgcttc
gccaaccactcggtcaaccccaactgctatgcaaaggtgatgatggtgagcggggatcac
cgaatcggcatctttgccaagagagccatccagaccggagaggagctcttctttgactac
aggtacagccaggcggacgccttgaagtacgtggggatcgagcgcgagatggagatcgcc
tga

DBGET integrated database retrieval system