KEGG   Oryzias latipes (Japanese medaka): 100302449Help
Entry
100302449         CDS       T02443                                 

Definition
c-type lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
ola  Oryzias latipes (Japanese medaka)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 143 aa AA seqDB search
MKSLVFLLLVAGASAKVFERCQWARLLKAQGMDGYRGVSLANWVCLTQHESRFNTNAINH
NRDGSTDYGIFQINSYWWCDDGKTGRVNGCKIPCSALLSDSVGTAIACAKRIVQDPSGIA
AWVAWRDHCRGRDVSSYIQGCGF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccttgtgtttttgctgttggtggccggtgccagtgccaaagtgtttgagcgc
tgtcagtgggcccgcctgctgaaggctcagggaatggatgggtatcgcggtgtgagcctg
gccaactgggtctgcctgacacaacatgagtctagattcaacaccaatgccatcaaccac
aacagggacgggtcaacggattatggcatcttccagatcaacagttattggtggtgtgac
gatggaaaaaccggaagagtcaacgggtgcaaaattccatgcagcgcgcttctgtctgac
tcggtgggcacagccatcgcctgtgccaaacgcatcgttcaggatccaagtggcatagct
gcctgggtggcttggcgtgatcactgcagagggagagacgtgagttcctacatccaggga
tgtggattctga

DBGET integrated database retrieval system