KEGG   Oryzias latipes (Japanese medaka): 101154993Help
Entry
101154993         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like isoform X1
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101154993
   04370 VEGF signaling pathway
    101154993
   04068 FoxO signaling pathway
    101154993
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101154993
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101154993
   04621 NOD-like receptor signaling pathway
    101154993
   04622 RIG-I-like receptor signaling pathway
    101154993
  Endocrine system
   04912 GnRH signaling pathway
    101154993
   04914 Progesterone-mediated oocyte maturation
    101154993
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101154993
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101154993
  Infectious diseases
   05132 Salmonella infection
    101154993
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101154993
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101154993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
23
AA seq 422 aa AA seqDB search
MSLDGQMSPSTHTHTPSEDTPRRSRDEARAQLLRLRLQELSAAQNSRLRCPLCAAVSRRG
MAIAARSRSGFYRQEVNRTVWEVPERYRDLKQIGTGAYGTVCSAWDRRTGAQVAIKKLHR
PFQSKLFAKRAYRELRLLKHMRHENVIGLLDVFTAEISLDRFRDFYLVMPFMGTDLGKLM
KMEKLTEDRVQFLVYQILKGLKYIHSAGIVHRDLKPGNLAINPDCELKILDFGLARQADA
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMLLGKPLFKGSDHLDQLREIMK
ITGTPSPDFVVKLQSQDAKNYIRSLPKVPKKDLHYIFSKASSNAVCVLERMLLLDPECRA
SASEALELPFFNEFRDIEEETEALPYDQTMDNTDLPLDQWKRHTFTEILTFRPPRDSKGT
SL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggacgggcagatgtccccctccacacacacacacacaccgagcgaggacaca
cccagacggagccgtgacgaagcgcgcgcgcagctcctccggctgcgcctgcaggagctc
tcggctgcgcagaactcgcggctgcgctgcccgctgtgcgctgctgttagtcggcgggga
atggccatcgccgcgcggtccaggagcgggttctaccggcaggaagtcaacagaaccgta
tgggaggttccggagaggtaccgggacttgaagcagatcggaaccggagcttatgggacc
gtgtgttctgcatgggaccgccgcacaggagcacaggtggccatcaagaagctacaccgg
cccttccagtccaaactttttgccaaaagagcctacagagagctgcggctcctcaaacac
atgaggcatgaaaacgtcatcgggctcctggacgttttcacggcggagatctctctggat
cggtttcgggacttttacttggtgatgccttttatgggcaccgacctcggtaagctaatg
aagatggaaaagctgacggaggacagagttcagttccttgtttaccaaatcctgaagggc
ctgaagtacatccactctgcagggatcgtccacagggatctcaaacctggaaatttagcc
ataaacccagactgtgaattgaagattctcgactttggtctggcgaggcaggctgacgca
gaaatgaccggctacgtggtgacacgctggtacagagcgccggaggttatcctgaactgg
atgcactacacacaaaccgtggacatctggtctgccggctgcatcatggcagagatgctg
ctgggaaagccgctattcaaagggagtgatcacctggatcagctgagagaaatcatgaaa
atcactggaacgccgagccctgactttgttgtcaaactgcaaagccaagacgctaaaaac
tacatcagaagcttaccaaaagtgccaaaaaaggatttgcactacattttctccaaagct
agctctaacgctgtgtgcgtgctggaaagaatgctgcttttggaccctgaatgtagagcg
agcgcatcagaagcactggaacttcccttttttaacgagttcagagacatagaggaagag
accgaagctcttccgtacgaccagaccatggacaacacggacctgccactggaccagtgg
aaacgtcacacattcacagagatcctgaccttcaggccacccagagactcaaaagggaca
tcgctttaa

DBGET integrated database retrieval system