KEGG   Oryzias latipes (Japanese medaka): 101154993Help
Entry
101154993         CDS       T02443                                 

Definition
mitogen-activated protein kinase 12-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101154993
   04370 VEGF signaling pathway
    101154993
   04068 FoxO signaling pathway
    101154993
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101154993
   04621 NOD-like receptor signaling pathway
    101154993
   04622 RIG-I-like receptor signaling pathway
    101154993
  Endocrine system
   04912 GnRH signaling pathway
    101154993
   04914 Progesterone-mediated oocyte maturation
    101154993
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101154993
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101154993
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101154993
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101154993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 362 aa AA seqDB search
MAIAARSRSGFYRQEVNRTVWEVPERYRDLKQIGTGAYGTVCSAWDRRTGAQVAIKKLHR
PFQSKLFAKRAYRELRLLKHMRHENVIGLLDVFTAEISLDRFRDFYLVMPFMGTDLGKLM
KMEKLTEDRVQFLVYQILKGLKYIHSAGIVHRDLKPGNLAINPDCELKILDFGLARQADA
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMLLGKPLFKGSDHLDQLREIMK
ITGTPSPDFVVKLQSQDAKNYIRSLPKVPKKDLHYIFSKASSNAVCVLERMLLLDPECRA
SASEALELPFFNEFRDIEEETEALPYDQTMDNTDLPLDQWKRHTFTEILTFRPPRDSKGT
SL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgcgcggtccaggagcgggttctaccggcaggaagtcaacagaaccgta
tgggaggttccggagaggtaccgggacttgaagcagatcggaaccggagcttatgggacc
gtgtgttctgcatgggaccgccgcacaggagcacaggtggccatcaagaagctacaccgg
cccttccagtccaaactttttgccaaaagagcctacagagagctgcggctcctcaaacac
atgaggcatgaaaacgtcatcgggctcctggacgttttcacggcggagatctctctggat
cggtttcgggacttttacttggtgatgccttttatgggcaccgacctcggtaagctaatg
aagatggaaaagctgacggaggacagagttcagttccttgtttaccaaatcctgaagggc
ctgaagtacatccactctgcagggatcgtccacagggatctcaaacctggaaatttagcc
ataaacccagactgtgaattgaagattctcgactttggtctggcgaggcaggctgacgca
gaaatgaccggctacgtggtgacacgctggtacagagcgccggaggttatcctgaactgg
atgcactacacacaaaccgtggacatctggtctgccggctgcatcatggcagagatgctg
ctgggaaagccgctattcaaagggagtgatcacctggatcagctgagagaaatcatgaaa
atcactggaacgccgagccctgactttgttgtcaaactgcaaagccaagacgctaaaaac
tacatcagaagcttaccaaaagtgccaaaaaaggatttgcactacattttctccaaagct
agctctaacgctgtgtgcgtgctggaaagaatgctgcttttggaccctgaatgtagagcg
agcgcatcagaagcactggaacttcccttttttaacgagttcagagacatagaggaagag
accgaagctcttccgtacgaccagaccatggacaacacggacctgccactggaccagtgg
aaacgtcacacattcacagagatcctgaccttcaggccacccagagactcaaaagggaca
tcgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system