KEGG   Oryzias latipes (Japanese medaka): 101155020Help
Entry
101155020         CDS       T02443                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ola  Oryzias latipes (Japanese medaka)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 329 aa AA seqDB search
MSGSAGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQP
GEEPAGSIVQDSRLDHIFFAKQVINNACATQAIVSVLLNCSHSDIVLGDTLSEFREFSQS
FDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKDEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWINAVRPVIEKRIQKYSEGEIRFNLMSIVSDRKMIYEKKIAELQA
QLTEDEPMDTDQSSSFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIMELL
KTLAEYQQLMPLVEKAKEKQSAKKAQEAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagcgcaggggaatggtgtctgatggagagtgaccctggggtgttcacggag
cttatcaaaggttttggttgcaaaggagcccaagttgaagagatttggagtatggagccg
gagaattttgagaacttaaaaccagttcatggcttgatttttctgttcaaatggcaaccc
ggagaagagccagccggatcaattgttcaggactcaaggctagaccatatcttttttgcc
aaacaggtcatcaataatgcttgtgcgacccaggccatagtcagtgtcctgctcaactgc
tcccattccgacatcgtgctgggcgacacactgtcagagttccgagagttttcccaaagt
tttgatgcagctatgaaaggtttggctctcagcaattcagaggtgattcggcaggttcac
aacagctttgccaggcagcagatgtttgaatttgatgcaaaatcttcagctaaggacgaa
gacgccttccactttgtcagctatgttcctgtaaacggcagactgtacgagctggatgga
cttcgagagggaccgattgatttgggcgcatgcaaccaagatgactggatcaatgcagtt
cgaccagtgattgagaagagaatacaaaagtacagtgaaggtgaaatcaggttcaaccta
atgtcgattgtgtctgacagaaagatgatttatgagaagaaaattgcagaacttcaggca
cagctgactgaggatgagccaatggacacagaccagagcagttccttcctaagctccatc
cagtcagaaattgccaagtaccagctcctcattgaggaagaaaatcagaaacttaaaaga
tataagattgaaaatattcgacggaagcacaattacctcccttttatcatggagttgctg
aaaacactggcagaataccagcaattaatgccattggtagagaaggcaaaggagaaacaa
agtgctaaaaaagctcaagaggcaaagtga

DBGET integrated database retrieval system