KEGG   Oryzias latipes (Japanese medaka): 101155337Help
Entry
101155337         CDS       T02443                                 

Definition
mitogen-activated protein kinase 6-like
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101155337
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   101155337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 743 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGMVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFEVLGPSGRMLTEDVVSLTEVNSVYIVQEYMETDLSQLLE
RGPLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLILKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCMFAEMLTGRTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIRSDMSKPHTPLAKLLPDVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPISLHPFHIEDEVDDILLMDQSHSHTWDRYHESQF
SEADWQLHSTHDPDEVQVDPRALSDVTDDGEVQVDPRKYADVDREKFVDKSFDYSSPFSS
ERSWQDEHHENKYCDLQCSHTCNYKAVSPSYLDNLIWRDSEVNHYHEPKLIIDLSNWKEQ
QSKEKADRKAKSKCEKNGLVKAQIALQAAEKDNVQEKHQTEKPQSQQNQGFDFDSFIAST
IKLSLQPEPCQEVTLLSEVGLLNELNFSVSQLEAPRSTSMSKTISQEKEEKCLVNLAQLG
GGGLGVVPPSPWDGFGPAEIVGDSGCLIDEACWGPDQKDHSQKDVTYTSYLDHLFSRKEE
SIVETITSSEVEPSVVNELDDSFLDRNTEIVLNVQLESLALPGFDGCDDLPLKSIQASLT
PCAVKCSPQIAHKAYSSILKHLN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgagtcattgatgaacatccatggctttgacctgggttctcgctac
atggacctgaagcctttgggctacgggggcaacggcatggtgttctctgcagttgacacc
gactgtgacaagcgtgtagctgtgaagaaaattatcttgaccgatcctcagagtgtgaag
catgcgctgcgggaaatcaagattatcaggcgacttgatcacgacaacattgtcaaggtg
tttgaggtactgggccccagtggtcgcatgttgacggaggacgtagtgtcgctgacagaa
gtcaactcggtctacatagtgcaagagtacatggaaactgacctgagtcagctgctggag
aggggcccgctttctgagggccacgccaggctcttcatgtaccagcttctcaggggcctc
aagtacatccactctgccaatgtcctgcaccgtgacctcaagcctgccaacctgtttgtt
aacacagaggatctgatactgaagatcggggacttcggattggcccgcatcatggatccc
cactactctcacaagggccatctctctgaaggtcttgtcacaaagtggtacagatctcct
cgcctgctgctctctcctaacaactacaccaaagccatcgacatgtgggctgctggctgc
atgtttgcagagatgctcacagggagaaccctgtttgcaggagctcatgagctggagcag
atgcagttgatcctggagtccatccctgtcctgcgagaggaagaccgacaagagcttcac
agtgtcatcccggtcttcatccgcagcgacatgtcaaaacctcacacgccgctggccaag
ctgctgcctgacgtcagtccacaggccctggattttttggaaaagatcctgacctttaac
ccaatggatcgcctgactgcagaggaagccctggcccacccctatatggccgactactct
ttccccctggatgagcccatctctctgcatcctttccacattgaagatgaagtggatgat
attctgctcatggaccagagccacagccatacttgggacaggtatcacgagagccagttc
tcagaggctgactggcaattgcacagcacccatgacccagatgaggttcaggtcgacccg
agggcgctctctgatgtcacagatgacggggaggtccaggttgatccacgtaaatatgcc
gacgtagaccgggaaaagtttgtggataagtctttcgactactccagtccgttctcatcg
gagcggtcctggcaggacgaacaccacgagaacaaatactgtgacctgcagtgcagccac
acgtgcaactacaaggctgtgtccccctcctacctggacaacctcatctggagggatagt
gaagtcaaccactaccatgagcccaagctcatcatcgacctctccaactggaaggagcag
cagagcaaggagaaggcagaccgcaaggccaagagcaagtgtgagaagaacggtctcgtg
aaggcccagattgccctgcaggcagcggagaaggacaatgtccaggagaaacatcagacc
gagaagccccagagccaacagaaccagggctttgattttgattccttcatcgctagcacc
attaaactgagcctacagccggagccctgtcaggaggtgaccctgctcagcgaggtgggc
ctcctgaacgagctcaacttttccgtctcccagctggaagccccccgttccacctccatg
tccaagaccatcagccaggagaaagaggagaagtgtctggtgaacctggcacagttgggt
gggggagggctcggcgtcgtccctccaagcccctgggacggcttcgggcccgcagagatt
gttggggacagtggctgtttgatagatgaagcatgctggggccctgaccaaaaggaccac
tcacagaaggacgtcacatacaccagctacctggaccacttgttcagccggaaggaagag
agcatcgtggaaaccatcaccagttcggaggtggagccctcggtggtgaacgagttggac
gacagcttcctggacaggaacacggagatcgtgctgaacgtgcagctggaatctctggcc
ctgcctggcttcgacggctgtgatgacttgcctctaaaatccatccaggcatccctcacg
ccgtgtgccgtcaaatgctccccacagatcgcccacaaagcctacagcagcatcctaaag
catctgaattga

DBGET integrated database retrieval system