KEGG   Oryzias latipes (Japanese medaka): 101155437Help
Entry
101155437         CDS       T02443                                 

Gene name
gys1
Definition
(RefSeq) glycogen synthase 1 (muscle)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101155437 (gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101155437 (gys1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101155437 (gys1)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101155437 (gys1)
Glycosyltransferases [BR:ola01003]
 Polysaccharide
  Storage polysaccharide
   101155437 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 710 aa AA seqDB search
MPLARSLSVTSLSGLEEWDEEFELEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDVG
FTAWSLDAGRASCGTWAQSVFLGSTVKQTXAVLFGFLTAWLLGEFAAQSEEPPHIVAHFH
EWLAGLGLVLCRKRQLPVATIFTTHATLLGRYLCAGSVDFYNNLSKFNVDKEAGDRQIYH
RYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLVGQLPDVAKML
DKEDFTIMKRAIFATQRQSQPPICTHNMLDDSSDPILNSVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYIAARHMALAKAFPDTFIYEPHEPSSATGFRYPRPASVPPSPSLSRHSSPHHSEAE
EDEDERYDEDLEAEKDRVNIRQPYTATKNKTSANLGADENEDDAVANDKN
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcccgcagcctgtccgtcacgtccctctctggacttgaggagtgggacgag
gagtttgagttggaggatgccgttctctttgaaatagcttgggaagttgccaacaaagtt
ggaggcatttacaccgtcatccaaaccaaagctcgtctgaccgccgaggaatggggggag
aactatttcctggtgggtccctatgtagagagcaacgtgcgcactcaagtggagttgatt
gaacccaccaaccccgtgctgaagcggaccattgacaaaatgaactccagtgggtgtaag
gtatactttggtcgctggctgattgaaggtagtccttatgttgttctgattgacgtgggc
ttcactgcctggtctctggatgctggaagagcgagctgtgggacctgggcgcaatcggtg
ttccttggttcgaccgtgaagcaaacgnacgccgtgttgtttggttttctgacggcttgg
cttcttggagagttcgcagcccagtctgaggagcccccgcacatcgtggcccacttccac
gagtggctggctggcctggggctggtgttgtgcaggaagcgacagctgcctgtggcgacc
atcttcacaactcacgccacactactgggacgctacctgtgtgctggaagcgtggacttt
tacaacaacctttcaaagtttaacgtggataaggaagcaggtgatcgacagatctaccat
cgctactgtttggagcgagcggccgcacactgtgcccacgtctttaccacggtgtcacag
attacagccattgaggcggagcacctgctcaagagaaaaccagatattgtaactcccaac
gggctgaatgtgaagaagttctcagctatgcatgagttccagaacctccatgcacagagc
aagagtcggattcaagagtttgtcaggggacacttctacgggcatcttgacttcaatttg
gacaaatgtttgttcctcttcatcgctgggaggtatgaattctccaacaaaggagccgac
atcttcctggaagctttggccagactcaactatctactgagagtcaaccacagtgatgtg
actgttatagctttcttcatcatgccagcgcggacaaacaacttcaatgtggagacctta
aaaggccaagcagtcaggaaacagctgtgggatacagctcacactgtgaaggagcgcttc
ggcaagaagctctatgagtctcttctagtgggccagctgccagatgtggcaaagatgcta
gacaaagaagatttcaccatcatgaagcgtgccatctttgccactcagaggcagtcgcaa
cccccaatctgcacccataacatgctggacgacagcagcgaccccatcctcaactctgtc
cgccgcatcggccttttcaacagctctgctgaccgagtcaagataatcttccatccagag
ttcctttcatccacgtctcctctgctgccaatggactatgaggagtttgtcagaggctgc
caccttggtgttttcccttcttactatgaaccttggggctacacaccagctgagtgcact
gtaatgggaattccatcaatctccacaaatctgtcggggtttggctgtttcatggaggag
cacatagctgacccttcagcatacggcatttacatccttgaccggcgttacaagggcgtc
gacgagtcgtgtaaccagctcacctccttcctgttccaattctgcaaacagagccgacgt
cagcggatcatccagaggaatcgaaccgagcgcctgagtgaccttctggactggagatac
ctcggcaggtattatatagctgcccgtcatatggccttggctaaagcctttcctgatacc
ttcatatatgaacctcatgagccgagctcagctacagggttccgttaccctcgaccggcc
tctgtaccaccttctccatccctgtcccgccactcctctccgcaccacagcgaggccgaa
gaggatgaagacgagcgttacgatgaggatctggaggcagaaaaggacagagtcaacatc
cgccagccctacaccgcaactaaaaacaaaacctctgccaacctgggagctgatgagaac
gaagacgacgctgtcgccaatgacaaaaactga

DBGET integrated database retrieval system