KEGG   Oryzias latipes (Japanese medaka): 101155631Help
Entry
101155631         CDS       T02443                                 

Definition
histone deacetylase 9-B-like
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101155631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 621 aa AA seqDB search
MLQTIYEGESSFSTTEGRVGHQQLPNQTKMHNVNNSDIKPDVPLAVEPLSPLDLRTDLRM
LGPGSDHGLWERQLQQELLLIQKQQQIQKQLLISEFQKQHEKLTRQHQAQLQEHLKLQQE
LQAMKQQQELAEKERRLEQQQQQSHQEKEQERHRREQLVSSLSLRGKERSRESAVASTEV
KQKLQEFLLSKSAKDPVVNGTNHSFVHHPKLWYTSSHHTSLDQSSPPLGGTSPTCHYTLP
SPIENKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPMLKRRDGNIMTPYKKRALELMDS
SATNSAPGSGPSSPIGASSALGTENGPSSLPTTTKTERWPSQPRLFRPEGSMSMLSLYTS
PSLPNISFGLSNASSSISAAIGLKDRSTEIKHGLPGHLLGPVPLHTALESKVSPSHQALL
QHLLQKEQMRQQKIITSGQSSMSPHPQSPLAMKDRPSSSRPKLPKHRPLNRTQSAPLPQN
TLAQLVIQQQHQHFLEKQKQYQQQVHINKLLSKSIEQLRQPSAHLQESEEELEDQQQQQH
KDDIERMQEDALPPGGVIRKHMLSSSSGSSSEMPDAPCGVIKVKEEPVDSEDEALTNQRL
QSEQSTYLHQVKGRLVIRAMI
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacgatttacgagggcgagtcaagtttctccacaacagaggggcgcgtcgga
caccagcagctccccaaccagaccaagatgcacaacgtgaacaactcagatataaaacca
gacgtgccattggctgtggagcccttatcacccttggacctgcgcactgacctgaggatg
ctggggccaggctcagaccacggcctgtgggagaggcagctacagcaggagctgcttctc
attcagaagcagcagcaaatccagaaacagttactgatcagcgagttccagaagcagcat
gagaagctgacccggcagcaccaggcccagctccaggagcatctcaagcttcagcaggag
ctccaggccatgaagcagcagcaggaacttgcagagaaggagcggcgactggaacagcag
caacagcaaagccatcaggagaaggagcaggagaggcaccggcgagagcagctcgtctcc
agcctgagcctgaggggcaaggagcgatcccgagagagtgcagtggccagtacagaagtg
aagcagaaactccaagagtttctgttgagtaaatccgccaaggatccagttgtcaatgga
actaatcattcttttgtccaccaccctaaactctggtacacgtcctcacaccacacatca
ctggaccaaagctctccacctctgggtggcacatccccgacctgtcattacactctgccg
tcacccatagagaacaaggatgacttccccttgagaaagacagcgtctgagccaaacctg
aagttacgatccagactgaagcagaaggtggctgagaggagaagcagcccaatgctaaag
agaagagatggaaacataatgaccccatacaaaaagagggctctagagctaatggactct
tcggcgaccaacagtgcccctgggtctggccccagctctcccattggggcttccagtgcc
ttggggactgaaaatggaccctcctcactgcctactactacaaaaacggagagatggcct
tcccagccaagattattccggcctgaaggctccatgtccatgctaagcttgtacacttct
ccgtctttacccaacatctcctttgggctttcaaatgcatcctcctccatcagcgctgct
atagggttgaaagatagatccactgaaatcaagcatgggctgcctgggcatcttttgggt
cctgtgccccttcatacagctctagagtctaaggtgagccccagtcaccaggctctcctc
caacacctcctgcagaaagagcaaatgcggcagcagaagatcatcacatctggccaaagc
tccatgtcaccccaccctcaatctcctctggccatgaaggatcgcccctccagcagtagg
cctaaactaccaaaacacagacctttgaacagaacccagtcggcgccactgcctcagaac
acattggcccaactagtcatccagcagcaacaccagcacttcctggagaagcagaaacaa
taccagcagcaagttcacataaataagctgttatccaagtccattgagcagttacgtcag
cccagtgcacatcttcaggaatcagaggaggagctggaggatcagcagcagcagcagcac
aaagatgacatagagagaatgcaagaggacgcgctgccccctggaggagtcattcggaag
cacatgctgagcagcagcagcggctcaagcagtgagatgccagacgctccctgtggggtc
atcaaggtcaaggaggagccagttgatagtgaggatgaagctctgaccaatcagcgcttg
cagtcagagcagagcacctatcttcaccaggtcaaaggaagactggtgataagagccatg
atctga

DBGET integrated database retrieval system