KEGG   Oryzias latipes (Japanese medaka): 101155742Help
Entry
101155742         CDS       T02443                                 

Gene name
p4hb
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101155742 (p4hb)
Enzymes [BR:ola01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101155742 (p4hb)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101155742 (p4hb)
  Exosomal proteins of colorectal cancer cells
   101155742 (p4hb)
  Exosomal proteins of bladder cancer cells
   101155742 (p4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 511 aa AA seqDB search
MLKFLMLCTLAVASRAEIAEEEDVLVLKKSNFDEALQAHPNILVEFYAPWCGHCKALAPE
YAKAAGMLKAEGSQIRLGKVDATEETELAQEFGVRGYPTIKFFKGGDKESPKEYSAGRQA
DDMVNWLKKRTGPAVTSLTEVTDAESLIADNEVAVIGFFKDANSDDAKAYEKAAEAMDDV
PFAITSSDAVYSKFEVSKDGVVLFKKFDEGRNTFDGELTKDGLLAFVKANQLPLVIEFTE
QTAPKIFGGDIKSHILMFLPKAASDFQEKMEQFKKAAAGFKGQILFIFIDSDVDDNQRIL
EFFGLKKEECPAIRLITLEDEMTKYKPESKDITAESIVAFCTQFVEGKLKPHLMSQDIPE
DWDKNPVKVLVGKNFEEVAFDPKKNVFIEFYAPWCGHCKQLAPIWDKLGEKYKDSSDIVV
AKMDSTANEIESVKVHSFPTLKFFPAGEERQVIDYNGERTLEGFTKFLESGGKEGGAPAG
DDDDDVESQDLDDADDLSDLEDGGEDGHDEL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagtttttgatgctttgcactctggccgtggccagcagggctgagattgcggag
gaagaagatgtcttggtgctgaagaaaagtaatttcgacgaagctctccaagctcacccc
aacattctggtcgagttctacgcaccatggtgcggccactgcaaggccctggctccagag
tacgccaaagccgccggcatgctgaaggccgagggttcccaaatccgcctgggtaaggta
gacgccacagaggagaccgagctggctcaagagtttggcgtccgaggatatcccaccatc
aagttctttaaaggaggagataaagaatctcctaaggagtactcggctggcaggcaggct
gatgacatggtcaactggttgaagaagcgcacagggcctgccgtcacctccctgaccgag
gtcactgatgcagagtctctgatcgctgacaacgaggtggcagtcatcggctttttcaag
gatgccaactcagacgatgccaaagcctatgaaaaagcagctgaggccatggatgacgtt
cccttcgccattacctccagcgacgctgtttactctaaatttgaggtatccaaggacggc
gttgtcctcttcaagaagtttgacgaagggcgaaacacctttgatggggagctgaccaaa
gacggcctccttgcttttgtcaaagccaaccagctgcctctggtcatcgagttcaccgag
cagaccgcgcctaaaatcttcggcggagacatcaagtcccacatcctcatgtttttgccc
aaagctgcttcagacttccaggagaagatggagcagtttaagaaagctgcagcaggattc
aagggtcagattctcttcattttcatcgacagcgacgtcgacgacaaccagcgcatcctg
gagttcttcggcttgaagaaggaagagtgccccgccatccgcctcatcaccctggaggac
gaaatgaccaaatataaaccagagagcaaagacatcaccgcagagagcatcgtggccttc
tgcacacagtttgttgaaggcaaacttaagcctcacctcatgagccaggacatccctgaa
gactgggacaaaaaccccgtcaaggttttggtcggcaaaaactttgaggaggttgctttc
gaccccaaaaagaacgtcttcatcgagttttatgcaccctggtgtggacactgcaaacag
ctggcccccatttgggacaaactgggagagaaatacaaggacagttctgacatcgttgtg
gctaagatggactccacagccaatgagatcgaatctgtcaaagtccacagctttcccact
ctgaagttcttccctgcaggagaggagcgacaggtgattgactacaatggcgagcgaacg
ctggagggcttcacaaagttcctggagagtggagggaaagaaggcggcgctcctgctggg
gacgacgatgatgacgtggaatcccaggatttggacgatgcggatgacctttctgacctg
gaggatggaggcgaggatggacacgacgagttgtaa

DBGET integrated database retrieval system