KEGG   Oryzias latipes (Japanese medaka): 101155828Help
Entry
101155828         CDS       T02443                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L1-like
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101155828
Peptidases [BR:ola01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101155828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 289 aa AA seqDB search
MEWTPMEINPEMLNKIMSKLGVGDSWCFVDVLGLEGEQLSAVPKPCCALMLLFPLTQQHE
SFRAQQADKVDDGSEVYFLKQKAGNSCGTIALLHAVANNKDKMAFDAGSALKKFLEETAN
MSPDDRAKHLEQNKAIYDAHNEVAMQGQCRPEADKINFHFIAFINAKGNLYECDGKMDGP
XXXXXXHESFRAQQADKVDDGSEVYFLKQKAGNSCGTIALLHAVANNKDKMAFDAGSALK
KFLEETANMSPDDRAKHLEQNKDAAKVCRGFTEREKDEVRFSAVALCRS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaccccgatggaaatcaaccctgagatgctgaacaagattatgagcaaactt
ggtgttggtgacagctggtgctttgttgatgtgcttggattggagggtgagcaactttct
gctgtgccaaaaccatgctgtgccttgatgctgctcttcccactcacacaacagcatgaa
tctttcagagcccagcaggcagacaaggtcgacgatggatctgaggtttatttcttaaag
cagaaagcgggcaactcctgtggcaccatcgctctgctgcacgctgtggccaacaataaa
gacaaaatggctttcgatgctggatctgccttgaagaaatttctagaagagactgcaaac
atgtctcctgatgatcgagccaaacatctggaacagaacaaggccatctatgatgctcac
aatgaagttgctatgcagggtcaatgccggccagaggccgacaagatcaacttccacttt
attgctttcataaacgccaaaggaaatctttatgaatgtgatgggaaaatggacggacca
nnnnnnnnnnnnnnnnnncatgaatctttcagagcccagcaggcagacaaggtcgacgat
ggatctgaggtttatttcttaaagcagaaagcgggcaactcctgtggcaccatcgctctg
ctgcacgctgtggccaacaataaagacaaaatggctttcgatgctggatctgccttgaag
aaatttctagaagagactgcaaacatgtctcctgatgatcgagccaaacatctggaacag
aacaaggatgcagccaaagtgtgccgtggcttcacggaaagggaaaaagacgaagttcgc
ttttctgctgtggcgctctgtcggagttaa

DBGET integrated database retrieval system