KEGG   Oryzias latipes (Japanese medaka): 101156070Help
Entry
101156070         CDS       T02443                                 

Gene name
suv420h1
Definition
(RefSeq) suppressor of variegation 4-20 homolog 1 (Drosophila)
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101156070 (suv420h1)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101156070 (suv420h1)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101156070 (suv420h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 927 aa AA seqDB search
MEAVLKGVFFNVKRLSMPCCITVEVPTHSSVRPGFKLQTPVFPTQESLFISETKCNWTRG
LVGMKWPGESKNMVLNGRRHGNKLTGEQAVSRSQPPQRASLRHVKSHPRSRRCSRRCNGA
SVEAERRYVPSSGMTAKELCENDDLTTSLILDPYLGFQTHKMNTRFRPIKGRQEELKDII
ENFKKHDNLEKAFKALTSGDWCRNLFLHKSKAQEKLFKQHVFVYLRMFATDSGFEILPCN
RYSSEQNGAKIVATKEWKRNDKIEFLVGCIAELSESEENMLLRHGENDFSVMYSTRKNCA
QLWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGESNEFCEC
YTCERRGTGAFKSKAGLPVEAPVINSKYGLRETDKRLNRLKKLGEGNRSSDSHSVGSHTD
LDSQEMPKTHQAVRKRTPSSSSSSSGLKYKNRTQSRQTLSRALSTSCSKQGRVNNNNNNN
RVPKRLKSQSKPSLSKVQLRSQRRGVEPRAPARADCQLGLRDSKGLTCKDVAIKKEKDAQ
EPGQLALSQQGCLTRHATRECSSHPAAQGGKSSSYRTRRSTRTLVKAQELVTCVKLEPSA
MDGLSPVPGGVVIKTEPADMEEYLHHGVGLEQPMLDSGYARRGLRTSWKRLPRSRTDRTV
KCEGSNCEPFMSGAVGHPPDFSDCANGLSGFASRHRDYNCIASGAKSLHGDKGKSSYRSQ
DKGKKKRRITRYDAQLILENNTGIPKLTLRRRRDSSSSKTNDANDIGSSTLSASTVSSAS
SSKISIKFSKDHDKDKGSSYVAKLNNGFTPIVHSNSTKLKIQLKREDDARQTSQAAYHGD
VVQSLDTRIGGYRTQKVLAEPSSDEDDEEDDDDEEGEDDDDYFDNEFEDDFIPLPPAKRL
RLIVGKDSIDIDITSRRREDQSLRLNA
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgtgcttaagggagttttttttaacgtgaagaggctcagcatgccctgttgc
atcaccgtggaggttcctacccatagcagtgtccgtccaggtttcaaacttcaaacccca
gtcttccctacccaagagtctctcttcatctcggagactaaatgcaactggaccaggggg
cttgtgggcatgaagtggccgggcgaatccaagaacatggtattgaatggcagacgacat
gggaacaagttgactggagagcaagctgtgagtcgctctcagcccccacagagggcatcg
ctgcgccacgtcaaaagccacccgagaagtcgaagatgtagccgcaggtgtaatggagcc
agcgttgaggcagagaggcgctacgtgccctcctcaggaatgaccgccaaagagctgtgt
gagaacgatgatttgaccacaagcctaatcctggatccatatctgggctttcagactcac
aaaatgaacaccagatttcgcccaatcaaagggagacaagaggagctgaaggacatcatc
gagaacttcaagaaacacgacaatttggaaaaggcttttaaagctctcacgtctggcgac
tggtgccgaaatttgttccttcacaagtccaaggctcaagaaaagctcttcaagcaacat
gtgttcgtatatttgcggatgtttgccacagatagcggctttgagattcttccctgtaac
cggtattcatctgagcagaacggcgctaaaattgtggccactaaggaatggaaaagaaac
gataagatcgagtttttggtcggctgcatcgccgagctttcagagagtgaggagaacatg
ctgctgcgccacggcgagaatgacttcagtgtcatgtactccacacgcaagaactgcgcc
cagctttggcttgggcccgctgcgttcatcaatcacgattgtcgaccaaactgcaagttt
gtgtcgacgggacgggacacggcctgcgtgaaggtcctcagagacattgagccaggagag
gaaatctcttgttactacggagatggcttctttggggagagcaatgagttctgtgaatgc
tacacctgtgaaagacggggtaccggggctttcaaatccaaagctggactgccagtggag
gcgccggtcatcaacagcaagtatgggttgcgggagacggacaaacggctcaacaggctg
aagaaactcggagaaggaaaccggagttcagacagtcactctgtgggctctcacactgac
ctagactctcaggaaatgccaaaaacacatcaagcagtcagaaagagaacaccatcttca
tcatcatcctcatctggcttgaagtacaaaaacaggacacaaagcaggcagactctgtcg
agagccctctctacctcatgttcaaagcaaggtcgtgtaaacaacaacaacaacaacaac
agggtaccaaagagactgaaatcccaatccaagccttcactcagcaaggtccagctgcga
agtcagagaagaggggtggagcccagggcaccagcccgagcggactgtcagctgggtctc
agggactcgaagggattgacgtgtaaagacgtcgccattaagaaggaaaaggatgcacag
gaaccgggtcagttagcactgagtcagcaaggctgccttacgcggcacgctaccagggag
tgcagcagccatccagctgcgcagggcggcaagagctcctcctacagaactcgcaggtcc
acaaggacccttgtaaaggcccaggaactagtaacttgtgtcaaactggagcccagcgcc
atggatggcttaagcccagtccctggcggtgtggtcatcaagactgagccagcagatatg
gaggagtacctccaccatggagttggcctggagcagccaatgttggactctggttatgcc
agaagaggcttgcgcaccagctggaagcggctgccgcggtccaggactgatcggacagtt
aaatgcgagggctcaaactgtgagccgttcatgtctggggccgtgggccatccccccgac
ttctcagactgtgctaacggactttccggcttcgccagcagacacagggactataactgt
attgccagtggcgccaagtccctccacggggataaagggaagagcagctaccgctcccag
gataaggggaaaaagaagcgacgcatcacgcgatacgacgctcagctgatcctggaaaac
aacacaggaatcccaaaactgacgctccgccggcggagggacagcagcagcagcaagacc
aacgacgccaacgacattggctcctccaccctctccgcatccaccgtcagctcggcctct
tccagcaaaatcagcatcaagttcagcaaggaccatgacaaggacaaaggcagctcgtac
gtggccaaactgaacaacggcttcacccccatcgtccacagcaactcaaccaaattaaaa
atccagctgaagagggaggacgacgctcgccagacttcacaggccgcctaccacggggac
gtggttcagagcctggacacccggatcggtgggtatcgaacccagaaggttctggccgaa
ccttcgtctgatgaggatgatgaggaggatgatgatgatgaggagggggaggatgatgac
gactattttgacaatgaatttgaagatgacttcattccacttcccccagcaaagcggctc
cgcctcattgtgggcaaagactccatcgacattgacatcacctccaggaggagagaggat
cagtctctgaggctcaacgcgtga

DBGET integrated database retrieval system