KEGG   Oryzias latipes (Japanese medaka): 101156399Help
Entry
101156399         CDS       T02443                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:ola00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 384 aa AA seqDB search
MKAVGSRFSFYAGFVVGTFTLYVFLRQVWFERTDTRGFADPGEFQQQLEEENKIWKKERS
ALFNLKHPHHIGEDSHLADALYKKVRILCWVMTGPNNLEKKARHVKYTWSRHCNIVIFMS
SVDDPDFPTVGLGTKEGRDQLYWKTIRAFHYAYEHHAEEADWFLKADDDTYVIVDNLRWI
LANYTAQDPIYFGRRFKPYAKQGYMSGGAGYVLSREALRRFVEGFQSKVCTHTTSVEDLA
MGQCMEKVGVKAGDSRDSAHRETFHPFVPESHLTGKFPKSFWYWSYCYYPIVEGPQCCSD
LSVSFHYVDAAGMYLLEYYAYHLRAFGYRHRYQSPTPKGLRLEQSGKHQHELTSQEKERG
QVEHKEDGPPGDAREPPAAPQEGN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtggggtccaggttctccttttacgcggggttcgtcgtggggactttcacc
ctgtacgtgttcctgcggcaggtgtggtttgagcggacggacacgcgcggctttgctgat
ccgggtgaatttcagcaacaactggaggaagaaaataaaatctggaagaaggagagatca
gcacttttcaacctaaagcacccacaccacataggtgaggacagccacttggctgatgcc
ttgtataaaaaggtgcgcatcctttgttgggttatgactggacccaacaacctggagaag
aaggctcgtcacgtgaagtacacgtggagtcgccactgcaatatagtgatcttcatgagc
tctgtggacgacccggactttcctacggtgggattaggaacaaaggaagggcgtgatcag
ctgtactggaaaacaatacgagccttccattatgcctacgagcatcatgcagaagaggca
gactggttcctcaaagcagacgatgacacttacgtcatcgtggacaacctgcgctggatc
cttgccaactacacggctcaagaccccatttactttggacggcggttcaagccctatgcc
aagcagggatacatgagcggcggtgcgggctacgtgctgagcagggaagctctgcggagg
tttgtggaaggctttcaaagcaaagtgtgcactcacactacctctgtggaggatctggcc
atggggcagtgcatggagaaggtgggagtgaaggcgggagactccagagactctgcacac
agggagacttttcacccatttgtgccggagtcgcacctcactggcaagtttccaaagagt
ttctggtactggagttactgctactaccccattgtagagggccctcaatgctgctcggat
ctgtccgtgtcctttcattacgtggacgctgcaggcatgtatctgttggagtactatgcc
taccacctgcgtgcctttggctacagacaccggtaccagtcccccaccccaaaaggtttg
agactggaacagtccggaaagcatcaacatgagctgacctctcaggaaaaagagcgaggg
caggtggagcacaaagaagatggcccccccggagatgctcgggagcctccggcagctcca
caggagggaaactga

DBGET integrated database retrieval system