KEGG   Oryzias latipes (Japanese medaka): 101156489Help
Entry
101156489         CDS       T02443                                 

Definition
nuclear receptor coactivator 3-like
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1453 aa AA seqDB search
MSGIGDNSLEPLRSDRKRKLSTCDTPGLGCDKRLREQESKYIEELAELISANLSNIDSFN
VKPDKCAILKETVRQIRQIKEQGPSSCSDDDVQKADVSSTGQGVIDKDHLGPLLLQALDG
FLFVVNREGSIVFVSDNVTQYLQYKQEELINTSVYNIIHDDNREEFHKNLPKPNGPNGQW
GGEAPRQKSHTFNCRMLVNLAHGASHGLSEDRPGGQRYETMQCFALTQPRAMMEEGDDLQ
SCMICVARRITAVERTERFTTRHELSGKLIEIEQQSSLHNTMRPGWEDLVRRCMQMFLNR
SDGQPWSYKRHYQDAFHTGRAETPLYRFSLSDGTLVTAQTRTDLCRNPSTNEPHSFLSTH
FLQREHNSYRGNPSGAMRPQNMGVNHPNQQMSMGQGGSMSMNRGYGIPDQGNMPQRGMAS
YSGGGRMNQMNHMNPMHQMNNMGQMNPMHPMNHMGSMNQMGHHGMHQQHTHTQMGQMHGG
PGGGGFGMGMTSPPQSSPGINGPPHNVLGSPRVRGSPKTGASPFSPGGMHSPMSSTHTGG
SGGGGGTTFSSSSLNALQAISEGLGNPMPSPLTSPLSHKPDSSPSINSTNQETGGKSALP
PYSESKSPGSSLRAGGEQQSQQHPQTPTSEGPPDKPDSQAGLGGGEANRRVPDKCNKKLL
QLLTSPTDDLVPSNHPQSSGSSSIPDSKDGMAGVTSPSSSTGVSSSTSGGHGAVSSSGSS
GHFPSQSLQEKHKILHKLLKDGNTPDEVAQITLLATGKSSLDSAAPEAGLSSTGGEKGSE
TKKEQHSPKKEKSHALLHYLLNKDDSKEGGDMKPKLEDLDGRGAPGAGVTSSDPHGMDGK
VKLEPSDEAETLETILGVRQNNSSFYPELDSRATKEVANKQGAVSESLHGRERGPMLPAQ
RAAYQRALSVDSKPMGGDMPVGGGLASRRNVPCPTLVKQESMEAPVRPGTMPNGFPGGMG
VCPPRGNPTRGIGRGMGAHQRPPMAGPGEWGMPRSGGSAAAGPGHPVMGRPGQMGGPMIS
RSISAPENMRSMLQQQLMDMGANESNVSMSPFGGQRPPPQSPSWPDSAMGMDRPQTSTNR
EQFPHPLEELLGPLPSSEGPGDDRALLDQLDSLLNNADVITLHEIDKALGIPEIVGQDHA
QGHCPPSEAFSAMDSSAGMDQKAMYSQGYPGPPTMGMQSAYAGNTGPPPGGFNPMMNQMG
PTGAFPGMGPMGNPRANMTRPRMMTATKPLRLQLQQRLQGQQPGFVNAQMLAQRQREAMT
TMQMRRQRMMMLMQQQQGQAAAGGFSPPPNVTAPAGMENPIGSPPITQPGQQGFNYGGSY
GMNQQGESFIPPGSSPPGHMMQGRMGGPQQNTMMPGMQGNPQGGHVYSSGDMKGWLQGNM
PRNNLYSQQQFPQQGNQGQFGSMMMNTSMGGTGPGSGSSVGQMTQMPGQMQGQMGMNPMG
MGRMPMGPDQKYC
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcataggagacaactcgttagagccgctgcgctctgaccgcaaacggaaactg
tccacctgtgacacaccaggattagggtgtgacaagcgtctgagggaacaggagagcaag
tacatcgaggagctggctgagctcatctctgctaacctctccaacattgacagctttaac
gtcaaacctgataaatgtgccatcctcaaggagaccgtcaggcagatcagacaaatcaaa
gagcaaggaccaagctcttgcagtgatgacgatgtgcagaaggcggatgtgtcttccacc
ggtcaaggggtcattgacaaagaccacctggggcctctcctcctgcaggcattagatggc
tttttgtttgtggttaaccgagaggggagcatcgtctttgtgtcagacaatgtgactcag
tacctgcagtacaagcaggaggagctgataaacaccagtgtttacaacatcatccatgat
gacaacagagaggagtttcacaagaacctccccaaacctaatggacccaatgggcaatgg
ggtggggaggcaccccgacagaaaagccacacattcaactgtcgcatgctggtcaacctc
gctcatggtgccagtcatgggctgtcagaagacagaccgggtggccaacgttatgagacc
atgcagtgttttgccctgactcagccccgcgccatgatggaggaaggagacgatttacag
tcgtgtatgatctgtgtggcccggagaatcactgccgtagagaggacagagaggtttacc
acccgacacgagttgtctggcaaactgattgaaattgaacagcagagctctcttcacaat
accatgcgtcccgggtgggaggacctagtcagacgctgcatgcagatgttcctcaataga
agtgatggtcaaccatggtcctacaagcgccattatcaggatgctttccacactggccgt
gctgagacgccactctatcgcttctcactctctgacggcacactggtcacagctcagacg
aggactgacctctgcaggaatcccagcaccaatgagccgcactcattcctgtctacacac
ttcctgcaaagggaacacaatagttatcgaggtaacccgagtggcgccatgagaccccag
aacatgggtgtgaaccaccccaaccagcagatgagcatgggccaaggaggaagcatgagc
atgaacagaggctacggcatacctgaccagggcaacatgccgcaaagaggaatggcttca
tactctggcggcggtcgcatgaaccagatgaatcacatgaatcccatgcatcagatgaac
aacatgggtcagatgaatccaatgcacccaatgaaccacatgggctccatgaaccagatg
ggccaccatggcatgcaccagcagcacacacacacgcagatgggtcagatgcatggagga
cctgggggtgggggttttgggatgggcatgaccagccctcctcagtcaagtcctgggatc
aacggccccccacacaatgttttgggttcgcctagggtcagaggaagccctaagactgga
gccagcccgttctcacctggaggcatgcactctcctatgagctccactcatactggtggc
tctggaggcggaggtggcaccaccttttccagcagctcgctcaatgccctgcaagccatc
agtgagggactgggcaacccaatgccctcccccctcacatcccctctttctcacaagcca
gacagctctccaagtatcaattctaccaatcaggaaacaggaggcaaatcagcccttccg
ccatactctgagtccaagagccccggcagctccctcagggctggcggggagcagcagtcg
cagcagcatccacagacccccaccagcgaaggacctcccgacaagccggacagccaggct
ggcctcggtgggggcgaagccaacagacgggtcccagacaagtgcaacaagaagcttcta
cagcttcttacatcccccacagatgatctggtgccatcgaatcacccacagagctctgga
tccagctccatacccgactcaaaggacggaatggctggggtcaccagtccctcctcctct
acaggagtatcctcttctacaagtgggggccatggtgccgtctcttcctcaggaagttct
ggacattttccgagccagtccttgcaagagaagcacaagatcctgcacaagctcctaaag
gatgggaacactccggatgaagtggctcaaatcacgttgttggccactggcaagagctct
ttggactcagcagcaccagaagcgggcctttcttctaccggaggggaaaaggggtctgag
acgaagaaggagcagcacagtcctaagaaagagaaatcccacgctcttcttcactatctg
ctcaataaagacgactctaaggaaggaggcgatatgaagccaaagctggaggatttggat
gggcgaggagctccaggagcaggagtcaccagctctgacccccatggtatggatgggaag
gtgaagctggagccatctgatgaggctgagactttggagactattttaggagtccggcaa
aacaattccagcttctaccctgaactggactccagagctaccaaggaggtagcaaacaaa
caaggggctgtttctgagagtctacatgggagggagagaggccctatgcttccagctcag
cgtgcagcctatcagagagccttgtctgtggattccaagcccatggggggggacatgcca
gtcggaggagggttggcgagcagacgaaatgtaccctgccccacgctggtcaaacaagag
agcatggaagctccagtccgacctggaaccatgcctaatggctttccaggaggcatgggt
gtttgtccaccaagggggaatccaacaagaggtattggtagaggcatgggcgctcatcag
cgccctcccatggcaggtccaggggaatgggggatgccgaggtctggtgggagtgcggcg
gccggtccaggacatccggttatgggtcgccctggccaaatgggaggacccatgatcagc
cgctccatcagcgcacctgaaaacatgaggtccatgctgcagcagcagctcatggatatg
ggtgccaatgaatctaatgtaagcatgagcccctttggcggtcagaggcccccacctcag
tcaccatcttggccagattctgccatgggaatggaccgaccacagacgagcacaaacaga
gaacagtttccacacccactcgaggagcttctcggacccctgcccagcagtgagggtccg
ggtgacgaccgggctctcctagaccaactggactccctgctcaacaatgctgatgtgatt
actctgcacgaaatcgacaaagctctgggaatccctgaaatagttggccaggatcacgct
caaggccactgccctccatcagaggccttctccgccatggactcttctgcagggatggat
cagaaagccatgtacagccagggttacccaggacctcctaccatgggaatgcagtccgct
tatgctggcaacacggggccccctcctggaggcttcaaccctatgatgaaccagatgggc
ccaactggggcttttcctggcatgggccccatgggcaacccgcgggcaaatatgacgagg
ccacgcatgatgactgccaccaagcctcttcgactgcagctgcagcagagactgcaaggg
cagcagcctggtttcgtgaacgcccagatgctggctcaacgccaaagggaggcaatgaca
accatgcagatgaggaggcaaaggatgatgatgctgatgcagcagcagcagggtcaggcc
gcagcaggaggcttcagcccccctcctaatgtcacagcaccagcaggcatggaaaaccca
attggctcccccccaataacccagcccggtcagcagggcttcaactatggaggcagctat
gggatgaaccagcagggggagtcgttcattcctccgggtagcagtccaccaggacacatg
atgcagggacggatgggaggtcctcaacagaacaccatgatgccagggatgcaggggaat
ccacaggggggccatgtgtactcgtcaggggatatgaaaggctggctgcagggcaacatg
ccacgcaacaacctgtattcccagcagcagttcccccagcagggtaaccagggccagttc
gggtccatgatgatgaacacctcaatgggtgggactgggccgggcagtggatccagcgtg
gggcagatgacccaaatgccagggcagatgcaggggcaaatgggcatgaaccctatggga
atgggcagaatgccaatgggacctgatcagaaatactgctga

DBGET integrated database retrieval system