KEGG   Oryzias latipes (Japanese medaka): 101156540Help
Entry
101156540         CDS       T02443                                 

Gene name
plcd4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 isoform X1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101156540 (plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101156540 (plcd4)
   04070 Phosphatidylinositol signaling system
    101156540 (plcd4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101156540 (plcd4)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101156540 (plcd4)
Membrane trafficking [BR:ola04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101156540 (plcd4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101156540 (plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
21
AA seq 749 aa AA seqDB search
MNPEGLCIQDDPDIKRMMAGSTLRKVKSRSWKKQRHFRLLEDGLTIWYKSKWAGKGHSTF
SVTEVEAVREGHQSEILLSTAEEFPADLCFTLVFHGRQGNLDLVAESLEEAQAWIQGVRK
LIHKAETMDEQERLDQWVRDWFQKADKNKDGKMNFKEVKKLLKMMNVEMNEEHAYHLFKM
ADKSQSDSLEIEQFVHFYKILTQRNEVWKVFQDYSGDGEKLMLDELENFLRTEQQEEEQS
TQHAKQLIESYEPSETVKKQGAMSLEGFQMYLCSQDGSIFKPGLLELYQDMSQPLSHYFI
SSSHNTYLLEDQLRGQSSLEAYIQALKRGCRCVEVDCWDGSDGEPVVYHGHTLTSKILFK
DVISTIKEYGFRASDFPIIVSLENHCGLEQQTLMAQHLTQILGDLLQTSTLDGQVPQQLP
SPQELKGKILLKAKKIGGLEKCVDETLTDEVSDEEEMANGDEESPTEEPQAEKKNKKSKL
SRELSDLVVYCKSVHFHGFEHAHCHAKCYEMSSFSESKAKKLGKEAGTEFVQYNTRQLSR
TYPSGLRTDSSNYNPQDMWNVGCQIVALNFQTAGLEMDLNDGLFKQNGGCGYILKPDFMR
DGNTQFCPEKPEERRDYKPRRLSIQVISGQQLPKVNQKEGSIVDPLVRVEIYGVPQDQAK
EETSHINNNGFNPVWNATLNFVIHTPELALVRFVVEDYDKASRNDFIGQFTLPFTCIQPG
YRHIHLLSKDGMAIPPSSLFVNISISDYE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgaaggtttatgcatccaagatgatccagatataaaacggatgatggcggga
tcaactctgagaaaagttaagtctcggtcctggaagaagcagcgccatttccgtctgtta
gaggatggcctcacgatctggtacaagtcaaaatgggctgggaaaggacactcaacattc
tcggtgacggaggtggaagcggtgcgtgaaggccatcagtcagaaatcctgctgagcact
gccgaggagtttcctgctgacctctgcttcactctggtgtttcatggtcgccaaggcaac
ctggaccttgtggctgagtctttagaggaggcccaggcatggatccagggagtccgcaag
ctaattcacaaagctgaaaccatggatgagcaggagaggctggaccaatgggtcagggac
tggtttcagaaagctgacaaaaacaaagatgggaagatgaatttcaaagaggtgaaaaag
ttgctcaagatgatgaacgtggagatgaatgaagaacatgcataccatctctttaagatg
gctgacaagtcacagagtgactctttggaaattgagcagtttgttcacttctataaaatc
ctgacccagagaaatgaggtatggaaggtcttccaggattattctggagatggagagaag
ttgatgctggatgagctggaaaatttcctaagaacagagcagcaggaggaagagcaaagc
acccagcatgccaagcagctgattgaaagctatgaaccatctgagacagtcaagaagcaa
ggtgccatgtccttggagggcttccagatgtacctgtgttcacaggatggctccatattc
aagccggggctcctggaactttatcaggacatgagccagccgctcagtcactacttcatc
tcctcttcacacaacacttatctcctggaggatcagctgcggggacagagcagcttggag
gcatacatccaggctctgaaaagaggctgccgctgtgtagaggtggactgctgggacggc
agtgacggggagcctgttgtgtatcacggccacacactgacctcaaaaatcctcttcaaa
gatgtcatttcaacaatcaaagaatatgggttcagagcttcagactttcctatcattgtt
tcccttgagaatcactgtggtttggagcagcagacgctcatggcccagcatcttacccag
atcctgggtgacttgctacagaccagcactctggatggacaggttcctcaacagctcccc
tcccctcaggaacttaaagggaagattttgctaaaagccaagaagatcggaggcctcgaa
aaatgtgtggatgaaactctgacagatgaagttagtgatgaagaagaaatggccaatggt
gatgaagagagtcctactgaggaaccacaagctgagaagaagaacaagaaatctaaactt
tccagggagctttcagacttggtggtttactgcaagagtgtgcacttccatggattcgag
catgcccactgtcatgcaaagtgttacgagatgtcctcattctctgaatccaaagcaaaa
aagcttggcaaggaagcagggacagaatttgtgcagtacaatacacgacaattgagcagg
acctatcccagcggcctgaggacggactcctccaactataatccacaggatatgtggaat
gtgggttgccaaatagtggctctgaacttccagacagccggtctggaaatggatctgaat
gatgggctctttaagcaaaacggcggctgtggttacatcctgaagccggatttcatgaga
gatggcaacactcagttctgtcctgagaagcctgaggagcgtcgagactataaaccacgt
cgtttatctatacaggtaataagtgggcagcagctaccaaaagtgaatcagaaagaggga
tctattgtagacccactggtgagagtggagatttatggcgtaccacaggaccaagccaag
gaggagaccagccatattaacaacaatggttttaacccagtgtggaatgcaactttaaat
tttgtcatccatacccctgaactggcactggttcgttttgtggtggaggactatgacaag
gcctccagaaatgactttattggacagttcactcttcccttcacttgcatccaaccagga
tatcgtcacatacatctgctatctaaagatggaatggctattcccccctcttcactcttt
gttaacatcagtatttcagactatgaataa

DBGET integrated database retrieval system