KEGG   Oryzias latipes (Japanese medaka): 101156806Help
Entry
101156806         CDS       T02443                                 

Definition
polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101156806
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101156806
    1.3.1.94  polyprenol reductase
     101156806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 274 aa AA seqDB search
MSWSFLNWSLDLIRYGKTKSLKRANWLRLFDVPKRWFWHFYIVSVCWNGFLLFVNLNLIY
HRQSYPSWLIAILDVLSGVPRPDSQVPQLSTALVQLLVWLHSLRRLLECLFVSIFSDGVM
HVVQYLFGLGYYITLGLTVLCVDRIGKGTASLSQVDWLQVTGFVLFICASLLQHQSIVLL
AGLRTGKSGAVETFAHRMPKGGCFQLVSCPHYFAELLIYVSLGFVFGGLSLTWWLVVLYV
FFNQALAGQLSHELYVSKYQSYPKDRKAFIPFVL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggagctttttaaactggagcctggatcttattcgctacggaaaaactaaaagc
ctcaaacgagccaattggctgagactgtttgacgtcccaaaacggtggttttggcatttc
tacattgtctctgtttgctggaacgggtttcttttgtttgtaaatttaaacttgatctac
catcggcaatcttacccatcatggctgattgctatattagatgtgttgtcaggtgttccc
cgccctgacagtcaggtcccacagctgtccacggctctggtgcagctgctggtgtggctc
cactcccttaggaggctgctggaatgcctgtttgtcagcattttctctgatggggtcatg
catgtagtgcagtatctgtttggccttggatattacattacactggggttgacagttctc
tgtgttgaccggattggaaaaggaaccgcctctctctcgcaggtggactggcttcaggtg
actggatttgtcctctttatctgcgcttcgctgctgcagcatcagtccatagtccttctg
gccggactgcggaccggaaaatcaggagcagtggagacgtttgctcatcgaatgccaaaa
ggaggctgcttccagttggtgtcgtgccctcactactttgcagagctgctcatctacgtc
tctcttggctttgtctttggtggactgtctttgacatggtggctggtggttctctatgtg
ttcttcaaccaggcgctggccggacagctgagtcatgagctttacgttagcaaataccag
tcatatccaaaggacagaaaagcctttatcccgtttgtgctttga

DBGET integrated database retrieval system