KEGG   Oryzias latipes (Japanese medaka): 101157017Help
Entry
101157017         CDS       T02443                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101157017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 1084 aa AA seqDB search
MNSHNHQVDVSPAALPSQVPPTSTAILPMDLRVVDHHHHQQQPAFGLVSQPHPSPAPGCP
ASEGGHGPVVGHQEHQLQHELVALKHKQQLQRQLLIAEFQRQHEQLSRQHEAQLQEHIKH
QQDLLALKHQQELLEHHRKMEQQRHDQLEKQQREQKLQQLKNKERGQESAVASTEVKMRL
QEFVLNKKKALAQRNLNHCLPSDLRYWYGKTHHSSLDQSSPPQTALSAYNHPMLGTYDLK
DDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGLITTAKKRSLDVAEPACNSAPG
SGPSSPNNSSSNIPNENGIPISSSHGEASLLQRLAAREGSVSQLSLYTSPSLPNITLGLP
ATGPASVVSGHQDGESHLALPALQQGIPLTPPFLPTAHLPSYLAPSALDREGPGGGTAGH
NPLLQHVVLLEQGHSPMVGLAGLPLPSPTVSKLVRGHRPLGRTQSAPLPQQPCGQAQALQ
QLVVQQQHQQFLEKHKQLFQQQQQHLISKIMSKPGDPASAVGSSASLPGRQHQSHPEETE
EELREHQGLSSSSSSPSSAPMQETRLLRAIKQEPPDPEEQEEREQRERHSEPDFLFKQQT
LLLEQQRIHQLRNYRATIEDSSLPGTLAGKRPLFRTQSSPASASLPMAVQESPVKHRFTT
GLVYDSLMQKHQCICGNSTIHPEHAGRIQSIWSRLQETGLRAHCEVIRGRKASPEELQTV
HSEAHVQLYGTNPLRQRLDCSVNPVFVRLPCGGIGVDSDTIWNEVHSSSAARLAVGSVVE
LVFKVASGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWD
VHHGNGTQQAFYADPNVLYLSLHRYDDGNFFPGSGAPDEVGSGAGVGFNVNVAFTGGLEP
PMADAEYLAAFRTVVMPIAKEFAPDMVLVSSGFDAVDGHAPPLGGYKVTSKCFGYLTRQL
MDLAGGRLVLALEGGHDLTAICDASEACISALLGNELEPIPEEVLQQRPNANAVSSLEKV
METHSKYWRSLQRSASTLCCSLSEALQHDVEEAETVSAMASLSVANKHIGKRAEEEPMEE
EAAM
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcacaatcatcaagtggatgtgagcccggcagcgctgccctcgcaggtgccc
cccacttcaaccgccatccttcccatggacctgcgcgtagtggaccaccaccaccaccag
cagcagcctgcttttggcctggtgtcccagccgcacccatccccggccccagggtgtcca
gcgtctgaaggcggccatgggccggtcgtcggccaccaggaacaccagctgcagcacgag
ctggtggctctcaagcacaagcagcagctccagaggcagctcctgatcgcagagtttcag
aggcagcacgagcagctgtcccgacaacatgaagcccagctgcaggagcacattaagcac
caacaggatctgctggccctcaaacatcaacaggagctgctggagcatcacaggaagatg
gagcagcaacgccacgaccagctggaaaagcagcagcgggaacagaaactccagcagctc
aaaaacaaagagaggggacaagagagtgctgtggccagcacagaggtgaagatgagactg
caggagtttgtgctgaacaagaagaaggcgctggctcagcgaaacctaaaccactgtctg
cccagtgacctgcgctactggtatggaaaaactcaccacagctctttggaccagagctca
ccgccccaaacagcactgtcagcctacaaccaccccatgctcggcacatacgacttgaaa
gacgacttccctctccgaaaaacagcgtccgagcccaacctgaagcttcgttcccggcta
aagcagaaggtggcggagcgccgcagcagccctctgctccgcaggaaggatggactcatc
accactgccaagaagcggtccctggatgtggcagaacctgcatgcaacagtgcaccaggc
tctggccccagttcccccaacaacagctccagtaacatcccgaacgagaatgggatcccg
atctccagcagccatggagaggcctctctgcttcagaggttggctgcaagggagggttca
gtcagccaactgtctctctacacctcaccgtctctgcccaacatcaccttaggactgcca
gccaccgggcctgccagcgtggtgtcgggacaccaagatggcgagagtcatctggcgctg
cctgcgttgcaacagggcattccactgactcctccttttcttcccaccgcccacctgcct
tcctacttggcaccttcagcgctggacagggaggggcctggagggggcacagctggtcac
aaccccctccttcaacacgtggttctgttggagcagggccacagtccaatggtcggcctg
gctggactaccactaccgtcccccactgtatccaagctggtgcggggccaccgtcccctg
gggaggacccagtcggcccctctgccccagcagccatgcggacaagcccaggccctgcag
cagctggtagtccagcagcaacaccagcagttcctggagaagcacaaacaacttttccaa
cagcagcagcagcacctcatcagcaagatcatgtccaagcctggtgatccggcctcggct
gtgggctccagcgcatcattgcctggcaggcaacaccagagccacccagaggagacggaa
gaggagctcagggagcaccagggactttcctcatcttcgtcgtcaccttcctctgctccg
atgcaggagacgaggttgctaagggccatcaagcaggagccaccagatcctgaagagcag
gaagaaagggagcagagggagaggcactcggagccggacttcctgttcaaacagcagacc
ctacttctggagcaacaacggattcaccagcttagaaactaccgggccactatagaagac
tccagcttaccaggcacccttgctgggaagcgtcctttgttcaggacgcagtcgtctcca
gcctctgcttctctccccatggcagtccaggagtcgccagtcaaacacaggtttacgaca
ggtctggtttatgactctttgatgcagaagcatcagtgcatctgtggaaactccacgatt
catccagaacacgccggccgcattcagagcatctggtcccggcttcaggaaacgggcctc
agggcacactgtgaggtcatccgtggaaggaaagcttctccagaggagctgcaaacggtg
cactctgaagcccacgtccagctgtacggaaccaaccctctgagacagagactagactgt
tcggtgaatcccgtgttcgtgaggttaccctgcggaggcatcggggtggacagcgacacc
atttggaatgaggtccattcatccagcgcagctcgtctggctgtcggctctgtggtggag
ctggttttcaaagtggcatcaggagagctgaagaacggtttcgccgtggttcgaccaccc
ggacaccacgccgaggagagcacgcccatgggtttctgctatttcaactctgtcgccatc
gcagccaaactcctgcagcagagactgaacgtcagcaaaatcctcatagtggactgggat
gttcatcacggcaacggcacccagcaggctttctacgcggaccccaatgtcctctaccta
tctctgcatcgttatgacgacggaaacttctttcccggcagcggagcccctgatgaggtg
ggaagcggagcaggtgtaggcttcaacgtaaacgtggccttcactggaggactggaacct
cccatggctgatgcagaatatttagctgcattcagaacggtggtcatgcctatcgccaag
gagtttgccccagacatggttctggtttcttctggctttgacgcagtggatggacatgcc
ccacctctgggaggttacaaagtcacatccaaatgcttcggctacctgaccaggcagctg
atggatctggcaggaggtcgtctggtgcttgccttggaggggggtcatgacctcacagct
atatgcgatgcctctgaagcctgcatctccgctctgcttggtaatgagttggagcccatt
cctgaagaggtgcttcagcagagaccaaacgccaacgccgtcagctctctagagaaagtg
atggaaacccacagtaaatactggcgctccctgcagcgctctgcctccaccctctgctgt
tccttaagtgaagccctgcagcatgacgtcgaagaagctgaaaccgtctcagccatggcc
tcactgtctgtggccaacaagcacattggaaagagagctgaagaggagcctatggaagag
gaagctgcaatgtaa

DBGET integrated database retrieval system