KEGG   Oryzias latipes (Japanese medaka): 101157053Help
Entry
101157053         CDS       T02443                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2-like
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101157053
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101157053
   04370 VEGF signaling pathway
    101157053
   04020 Calcium signaling pathway
    101157053
   04070 Phosphatidylinositol signaling system
    101157053
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101157053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1242 aa AA seqDB search
MAGVGQQGEMTEYRKILIKRDLEMGVVMTVFRQKAERLTVQVIMETRQVAWTRTADKTDG
VLDLLEIREIRPGRNSKDFERFKDGKDKHGENTCFTIFYGSQFVLSTLSLGADSVDEAQK
WLTGLEMLRQETQAAPTPVLIESWLRKQMYSVNQNKTNSISVKELKSLLPVLNYKAPSSR
TFKDKLLEVGIKKDRLDFEQFHKFYNLIMFEQNEILDEFKREACSFILGNTDKPDASAVL
LHDFQRFLIYDQKESWANNLNQVRELMTTFIDDTMRRTNDPEFTVSEFLGFLFSKENAVW
DEKYSEINNLNMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRCLRLGCRCVELDCWE
GPGEPIIYHGWTRTTKIKFEDVVKAINEHAFVTSDFPLILSIEEHCPIEQQRQMARIFKE
VFGDKLLTEPVEHMAEQLPSPTQLKGKIVLKHKKLNVEGGGFTKDFRKGQKQGDLEIWDP
VDQRWNKHYCVISDDKLYYAEEYEQEEEDPKKVKVYQDMHCSEPWFHGQMKEGRQMAERR
IHEYCTETGRRDGTFLVRQSDTYVTDYTLSFWRGGRVQHCRIRSGSEGGHTYFFLTPNLH
FPTVYSLIQHYKDMPLRCQDFELRLTDAVPKPDSHLQEGWFYSNLSRGQAEDYLLRIPRD
GAFLIRQREGEPDSFAITFRGDGKVKHCRIQKEGGMFLLGSTTEFESLVELVNYYKKKPL
YRKIKLRYPVTPELVQRFITDDKCASLYEIKTYVDPNEIEPAVPQNTVKAIYSYTAKRQD
ELSFSKGALIHNVFKESEGWWRGDCGGRIQLFFPANYVEEVFDQRQADTKSKEMEDNPLG
ELCKGIVDLSKCNIQHLKSGKSGKSHVLTVNNTDLDSVQFDLAADSLEELFEWYTVAWDI
SQRAISNKYNKDKEQVEVEKKAEVAMEMSDLVVYCQPRSKEKDRFDSYTYKEVRSFIENK
LPNKSRTKEFLQYNRKALSRIYPKSQRVESSNYDPYPMWAVGCHMVALNFQTADKCTQLN
TALFNLNGRTGYVLQPELMRSDTYDPYQEKKKVKYHIKLKVIAARHLPRPGRSIASPFVE
VELCGHTEEKFKTIVYHDNGLNPVWKSPAEPVEFTVYEPELTFLRFVVNEEDMFSDPNFL
AQATFPVIGLRSGYRSVPLKNGFSENLELASLLIYISVNQAGRVQEDLYSSSRQLKSEQA
EKSEPFLYDTHNNISRSSLPREFNPLVRDASERHKYGVHALL
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgtggggcagcagggcgagatgaccgagtacaggaagatcctgatcaaacgg
gacttggagatgggcgtggtcatgacagtgtttcggcagaaggccgagaggctcactgtc
caggtgattatggagacccggcaggtggcgtggacccgcactgctgacaagactgacgga
gtcttggacttgttggagatcagggagattcgtccggggagaaactccaaggattttgag
cgcttcaaagacgggaaagacaaacacggcgagaacacctgcttcaccatcttctacgga
tcccagtttgttctcagcactctcagtctgggagcggattctgtggacgaggcgcagaag
tggctcacagggcttgaaatgctgaggcaggagacccaggcagctccaactccagttctt
atagaaagctggctgaggaagcagatgtattctgtcaatcagaacaagaccaacagcatc
tctgtaaaggaactgaagtctctgcttcctgtgctgaactacaaggcccccagctctcgg
acgttcaaggacaaactgctggaagtgggcataaagaaagatcgtctggattttgagcag
tttcataagttttataatctgatcatgtttgaacagaatgagattcttgatgagttcaaa
agagaagcctgttcttttattctgggtaacacggataaaccggacgcctctgcggtgctc
ctgcacgatttccagcgcttcctcatttatgatcaaaaggaaagctgggccaacaatctg
aaccaagtcagagagctgatgaccacatttatcgacgacaccatgagaagaaccaacgat
ccagagttcaccgtcagtgagttcctcgggttcctgttttccaaggagaatgccgtgtgg
gatgagaagtactccgagatcaacaacctgaacatgaacaatcctttatcacattactgg
atcaactcctcacacaacacgtatctgaccggagatcagcttcgcagcgagtcgtccact
gaggcgtacgtccgctgcctgcgtctgggatgtcgctgcgttgagctggactgctgggaa
ggtcctggggagccaatcatctatcacggctggacgaggacaaccaaaatcaagtttgag
gatgtggtcaaagccataaatgaacatgcctttgtcacctcagatttcccgctcatcctg
tccatagaggagcactgtcctatagagcagcagcgtcagatggctcggatcttcaaggag
gtgtttggagacaaactcctgacggaacctgtggagcacatggctgaacagctgccgtca
cccacacagctgaagggaaagatcgtactcaaacacaagaagctcaatgtggagggcgga
ggattcaccaaagacttcaggaaaggccaaaagcagggagaccttgagatctgggaccct
gtggaccagcggtggaacaagcactactgtgtgatctctgatgacaaactgtactacgct
gaagagtacgagcaggaagaggaagatcccaagaaggtaaaagtctaccaagacatgcac
tgttcggagccgtggtttcatggtcagatgaaggagggcaggcagatggctgagcggcgg
atccatgagtattgcacagagaccgggagacgagacggtaccttcctggtccgacaaagt
gacacctacgtcactgactatacgctgtcattttggcggggtgggagagtccagcactgc
aggatccgctctggttcagaggggggtcacacgtacttcttcctgactccaaacctgcac
ttccccaccgtgtactctctgatccagcactacaaagacatgccgctgcgctgccaggac
ttcgagctgcgcctaaccgacgccgtgcccaagccggactctcacctccaggaaggatgg
ttctacagtaacctgagcagaggccaggcagaggattaccttctgaggattcccagagac
ggagctttcctcatccgacagagagaaggagagccagactcctttgccatcacatttaga
ggtgacggaaaggtcaagcactgccggatccagaaagaaggcggcatgttcctgctgggc
tccaccacagaattcgaaagcctggttgagctggtcaactactacaagaagaagcctctg
taccgcaagatcaagctacgctacccagtcacgcctgagctggtgcaacgattcatcacc
gatgacaaatgtgcgtctctgtatgagatcaaaacctacgtggaccccaacgagatcgag
ccagccgtgcctcaaaacacagttaaagctatatacagctacacagcaaagaggcaggac
gagctcagcttttccaaaggagctttgatacacaacgtgttcaaggagagtgaagggtgg
tggagaggtgactgtggtggaaggatacagctcttctttccggcaaactacgttgaggaa
gtgtttgaccaacgacaggctgacacaaagtcaaaggagatggaggacaacccactgggc
gaactatgcaagggcatcgtggacctctccaagtgtaacattcaacacttaaaaagtggt
aaaagtgggaaatcccacgtactgactgtgaataacacggacctggacagcgtgcagttc
gacctggccgcagactctctggaggagctgtttgaatggtacacagtggcctgggacatc
tctcagagggccataagcaacaagtacaacaaggacaaagagcaagtggaagtggagaag
aaggcagaggttgccatggagatgtcggacctggtggtctactgtcagccccggagcaag
gagaaagaccgttttgacagctacacatacaaagaggtgcgctccttcatagagaacaag
ctgccaaacaagagtcgcaccaaggagttcctgcagtacaaccgcaaggctctgagtcgc
atttaccccaagtcccagcgcgtggagtcctccaactacgatccttacccgatgtgggcc
gtcggctgccacatggtggccctcaacttccagactgcagataaatgcacccagctgaac
acagccctcttcaacctgaacggacgcaccggatacgtgctgcagccggagctcatgcgc
tccgacacctacgacccctatcaggagaagaagaaggtcaagtaccacatcaaactcaag
gtgatcgcagccagacacctccccagacctggacgcagcatcgctagcccgtttgtggag
gtggagctgtgtggacacacagaagagaagtttaagaccattgtttaccatgacaacggt
ctgaacccagtttggaaaagtccggctgagcccgtggagttcaccgtgtacgagccagaa
ctcaccttcctgcgcttcgtggtgaacgaagaagacatgttctcagaccccaacttcctg
gctcaggccacatttcctgtcataggcctacgttcaggttaccgctctgtacctctgaag
aacggcttcagcgagaacttggagctggcctctctgttgatctacatcagcgtaaaccaa
gctgggagggtccaggaggacctgtactcctcctcccggcagctgaagagcgagcaggcg
gagaaaagcgagcccttcttgtacgacactcacaacaacatttctcgctccagtctgcct
cgagaatttaacccgctagtgagggacgccagcgagagacataagtacggcgtccacgct
ttactgtga

DBGET integrated database retrieval system