KEGG   Oryzias latipes (Japanese medaka): 101157138Help
Entry
101157138         CDS       T02443                                 

Gene name
pomt1
Definition
(RefSeq) protein-O-mannosyltransferase 1
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101157138 (pomt1)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     101157138 (pomt1)
Glycosyltransferases [BR:ola01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101157138 (pomt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 728 aa AA seqDB search
MSRGQPLPEMLQLPLVVTVQVDLVLVLISSLAFLTRLSCLSYPNAVVFDEVYYGQFVSLY
MKRIFFIDDSGPPLGHIILALGAYLGGFDGNFVWNRIGAEYPMGMNVWSLRLLPALCGAL
CVPLGYLLALELKFSHVSALGAAVLLLLENSLIVQSRFLLLESVLIFFVLLALLSYLRFQ
NSTSSSWSRYGWLLLCGVSCAAAVGVKYMGLVSYLLLLGVASVDTWNVIGDRAASHLSVC
VQCFCRFMCLLVVPALLYIFWFYIHLSVLNHSGPHDQLMSSAFQASLKGGLSRITKGQPL
EVAFGSQVTLRSSASHPVPCWLHSHKANYPVRYENGRGSSHQQQVTCYPFKDVNNWWIIK
DPNRQDLVVDTPPKPVHHGDVIQLVHGMTSRFLNSHDVAAPMSPHAQEVSGYIDFNVSMP
AQNLWRVDITNREAKSEVWKTIVSDVRLVHVNTSAVLKLSGVSLPEWGFRQLEVVAEKAF
KVHSSSLGWTVEEHRYGTSQEQKDREVELHSPTHIDVDRKISFWAKFVELQWKMLTLKQE
ESEHKYSSSPVEWITMKTNIAYWLHTSTNAQIHLIGNLVSWGVAHLSMLAYQLLAVIYLL
RRRRGFKDISDGAWEQFVRLGCVCVGSWLVNFVPFLLMEKTIFLYHYLPALCYLHLLTPT
LLEHVHTHLLSSPTHRRLLHVCVIGVLLYVFLCFWTFCPLTYGTPELSASQLQRLKWRDS
WDILYRRQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcggacagccgcttccagagatgctgcagctcccccttgtggtcacagttcag
gtggacctggttctggttctgatcagctcgctggccttcctgacccgactcagctgcctg
agctaccccaacgcggtggtgttcgatgaagtgtattatggccagttcgtgtctctgtac
atgaaaaggatctttttcatcgatgacagcggtccccccctcggacacatcattctggct
cttggagcctacctgggaggattcgacggcaactttgtgtggaaccgaatcggagcagag
tatcccatgggcatgaacgtgtggagtttgcggctgctgccagctctctgcggggcgctc
tgtgttcctctgggttacctgctggctctggagctgaagttctctcatgtttcggctctc
ggagccgcagtgctgctcctgctagaaaactccttgatcgtccagtcccggttcctgttg
ctggagtcggtcctcatcttctttgtgctgttggctctcctgtcatacctgcgtttccag
aactccaccagcagctcctggtccagatatggctggctgctcctctgtggcgtctcctgt
gctgccgctgtcggggtgaagtacatgggactggtctcttatctgctgctgctgggtgtg
gcttctgtggacacatggaatgtgattggagatcgagctgctagtcatctgagtgtgtgc
gtgcagtgtttttgtagattcatgtgcctcctggttgttcctgcactgctttacatcttc
tggttctacattcacctgagtgtcctgaatcacagtggaccacatgaccagctgatgagc
tccgcctttcaggccagtctgaagggtggtctctctagaatcacgaagggtcagcctttg
gaagtggcttttgggagtcaagttactttgagaagctccgcctcccatccagtcccatgt
tggctccactcacacaaagctaactatccagtcaggtacgaaaatgggaggggcagctct
caccagcagcaggtgacctgttatccttttaaggatgtcaacaactggtggatcatcaaa
gaccccaacagacaagacttggtggttgacacacctcctaaacctgtccatcatggtgat
gtcatccagctagttcacgggatgacgtctcgcttcctcaacagtcatgatgtggcagct
cccatgagccctcacgcccaggaggtgtccgggtacatcgacttcaacgtctccatgcct
gctcagaacctgtggagggtggacatcactaacagagaggcaaagtccgaagtgtggaag
acgatcgtgtctgatgtgcgactggtccatgtcaacacgtctgctgttctcaagctgagt
ggcgtgtctcttcctgagtggggcttccgacagttggaggtggtggcagagaaagcgttt
aaagttcacagcagcagtttgggatggacggtggaggaacacagatatggaaccagtcag
gagcagaaggaccgggaagtagagcttcactctcccactcacattgatgttgacagaaaa
atttctttctgggcaaagtttgtggagctgcagtggaagatgctgactctgaaacaagag
gagtccgagcacaaatacagctccagccctgtggagtggatcaccatgaagacgaacatt
gcatactggctgcacacttccaccaatgctcaaatccatcttattggaaacctggtgtcc
tggggcgtggcccacctgagcatgctggcctatcagcttctggctgtgatttacctgctg
agaaggaggcggggcttcaaagacatttctgatggtgcgtgggagcagtttgtgcgtctt
ggctgtgtgtgtgtcggcagctggctggtgaacttcgtgcccttcctgctgatggaaaaa
acgattttcctgtatcactacctgcctgccctgtgctacctccacctgctgacccccacc
ctgctggagcatgtgcacactcacctgctcagcagccccacacaccgccgcctgcttcat
gtgtgcgtgataggtgtgctcctgtacgtcttcttgtgcttctggaccttctgccctctg
acctacggcaccccggagctgtcagccagtcagctgcagaggttaaagtggagggacagc
tgggacatcctgtaccgaaggcagtga

DBGET integrated database retrieval system