KEGG   Oryzias latipes (Japanese medaka): 101157155Help
Entry
101157155         CDS       T02443                                 

Gene name
cyp21a2
Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101157155 (cyp21a2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     101157155 (cyp21a2)
Cytochrome P450 [BR:ola00199]
 Cytochrome P450, animal type
  CYP21 family
   101157155 (cyp21a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 519 aa AA seqDB search
MASEMSAVSAGAVLLFVLFLILMLISCQRKKSQQGGAASGPLQGLYLFLFRSAPPSLPGP
PGHFLIGNMMELMHDHLPIHLTSLAQRYGSIYRLKCGNTTMVVLNSGELIRETLVRKWSD
FAGRPISYTGDIVSGGGRNISLGDYTEEWRAHRRLVHGALQRCCQQSLHSVIERQALHLR
KVLMGYQGSPVDLSEDFTVAASNVITTLAFGKEYDKSSSELQQLHSCLNEIVSLWGSSWI
SALDSFPLLRKLPNPVFARLLKEVARRDEIIKQHLDNFKLQGHQSEDSITGSLLQALDKH
QNTKEGQLLTDVHVHMATVDLLIGGTETTAAWLNWTVAFLLHRPEIQDKVYEELCTVPEG
RYPKYSDRQRLPVLCALVNEVLRLRPVAPLAVPHRAIRNSSIAGFFIPKNSVIIPNLFGA
HHDPAVWSEPYSFKPERFLEGGGGSTRALVPFGGGARLCLGESVAKMELFLFTAYLLRDF
QFILPESNVFPPDLRGIATVVLKIKPYKVIARPRPAIGP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaaatgtctgcagtcagtgctggggctgtactcttgtttgttctgttctta
attttgatgctgatttcttgtcaaagaaaaaaaagtcaacaaggaggagcagcatctgga
cctctgcagggtttgtatctttttctttttcgctctgcacctccatcacttcccggccct
ccaggccactttttgattggcaatatgatggagctgatgcacgatcacctaccaattcac
ctgactagcctcgcccaacgctatgggagcatttaccgccttaaatgtggaaacacaacc
atggtggtgcttaatagtggagaactgataagagaaactttggtgaggaaatggtctgac
tttgctgggaggccaatctcatacacaggtgatattgtgtctgggggaggacggaacatt
tctcttggggattatactgaggagtggagggcacatcgccgcctcgtccatggcgccctg
cagcgctgctgccagcagtctttacacagtgtgattgagaggcaggctcttcatctgaga
aaggttctgatgggctaccagggcagccctgttgatctctctgaagacttcacagtggca
gccagcaatgtcatcaccactttggccttcggtaaagaatacgataagagctcatcagag
ctgcagcagctgcacagctgtctgaatgagattgtgtctctgtgggggtcctcttggatt
tctgcactggattccttcccactgctgagaaaattgcccaaccccgtatttgctcgtctt
cttaaagaggtggccaggagagatgaaatcattaagcaacaccttgataattttaagttg
caagggcatcaaagtgaagactccataactggatccctcctccaagctcttgacaaacat
cagaacactaaagaaggacagctgttgacggatgtccatgttcacatggcgactgtggat
cttctcattgggggaactgaaaccacggcagcctggctgaactggaccgtggccttcctg
ttacacaggccagagatacaagacaaagtatatgaggagctgtgcacagttccagaagga
cgttatccaaagtacagcgacagacaaagactgcctgtcctgtgtgctctggtcaacgaa
gtgctcagactcagaccagttgctcctctagcggttccacacagagccatcagaaacagc
agtattgcaggtttcttcattcccaagaattctgtcatcattcctaatctttttggagct
catcacgatcctgcagtctggtctgagccgtacagcttcaaaccagagcgctttctggaa
ggtggaggaggctccacccgtgcccttgtgccttttggagggggagcgaggctctgcctg
ggggagtctgttgccaaaatggagctctttcttttcacggcttacctgttgagagatttc
cagttcatcctccctgagagcaacgtcttccctcctgacctcagagggattgccactgtc
gttctcaaaatcaagccctacaaagtcatagctcgtccgagacctgcaatcggtccttga

DBGET integrated database retrieval system