KEGG   Oryzias latipes (Japanese medaka): 101157155Help
Entry
101157155         CDS       T02443                                 

Gene name
cyp21a2
Definition
cytochrome P450, family 21, subfamily A, polypeptide 2
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101157155 (cyp21a2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     101157155 (cyp21a2)
Cytochrome P450 [BR:ola00199]
 Cytochrome P450, animal type
  CYP21 family
   101157155 (cyp21a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 519 aa AA seqDB search
MASEMSAVSAGAVLLFVLFLILMLISCQRKKSQQGGAASGPLQGLYLFLFRSAPPSLPGP
PGHFLIGNMMELMHDHLPIHLTSLAQRYGSIYRLKCGNTTMVVLNSGELIRETLVRKWSD
FAGRPISYTGDIVSGGGRNISLGDYTEEWRAHRRLVHGALQRCCQQSLHSVIERQALHLR
KVLMGYQGSPVDLSEDFTVAASNVITTLAFGKEYDKSSSELQQLHSCLNEIVSLWGSSWI
SALDSFPLLRKLPNPVFARLLKEVARRDEIIKQHLDNFKLQGHQSEDSITGSLLQALDKH
QNTKEGQLLTDVHVHMATVDLLIGGTETTAAWLNWTVAFLLHRPEIQDKVYEELCTVPEG
RYPKYSDRQRLPVLCALVNEVLRLRPVAPLAVPHRAIRNSSIAGFFIPKNSVIIPNLFGA
HHDPAVWSEPYSFKPERFLEGGGGSTRALVPFGGGARLCLGESVAKMELFLFTAYLLRDF
QFILPESNVFPPDLRGIATVVLKIKPYKVIARPRPAIGP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaaatgtctgcagtcagtgctggggctgtactcttgtttgttctgttctta
attttgatgctgatttcttgtcaaagaaaaaaaagtcaacaaggaggagcagcatctgga
cctctgcagggtttgtatctttttctttttcgctctgcacctccatcacttcccggccct
ccaggccactttttgattggcaatatgatggagctgatgcacgatcacctaccaattcac
ctgactagcctcgcccaacgctatgggagcatttaccgccttaaatgtggaaacacaacc
atggtggtgcttaatagtggagaactgataagagaaactttggtgaggaaatggtctgac
tttgctgggaggccaatctcatacacaggtgatattgtgtctgggggaggacggaacatt
tctcttggggattatactgaggagtggagggcacatcgccgcctcgtccatggcgccctg
cagcgctgctgccagcagtctttacacagtgtgattgagaggcaggctcttcatctgaga
aaggttctgatgggctaccagggcagccctgttgatctctctgaagacttcacagtggca
gccagcaatgtcatcaccactttggccttcggtaaagaatacgataagagctcatcagag
ctgcagcagctgcacagctgtctgaatgagattgtgtctctgtgggggtcctcttggatt
tctgcactggattccttcccactgctgagaaaattgcccaaccccgtatttgctcgtctt
cttaaagaggtggccaggagagatgaaatcattaagcaacaccttgataattttaagttg
caagggcatcaaagtgaagactccataactggatccctcctccaagctcttgacaaacat
cagaacactaaagaaggacagctgttgacggatgtccatgttcacatggcgactgtggat
cttctcattgggggaactgaaaccacggcagcctggctgaactggaccgtggccttcctg
ttacacaggccagagatacaagacaaagtatatgaggagctgtgcacagttccagaagga
cgttatccaaagtacagcgacagacaaagactgcctgtcctgtgtgctctggtcaacgaa
gtgctcagactcagaccagttgctcctctagcggttccacacagagccatcagaaacagc
agtattgcaggtttcttcattcccaagaattctgtcatcattcctaatctttttggagct
catcacgatcctgcagtctggtctgagccgtacagcttcaaaccagagcgctttctggaa
ggtggaggaggctccacccgtgcccttgtgccttttggagggggagcgaggctctgcctg
ggggagtctgttgccaaaatggagctctttcttttcacggcttacctgttgagagatttc
cagttcatcctccctgagagcaacgtcttccctcctgacctcagagggattgccactgtc
gttctcaaaatcaagccctacaaagtcatagctcgtccgagacctgcaatcggtccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system