KEGG   Oryzias latipes (Japanese medaka): 101157546Help
Entry
101157546         CDS       T02443                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00564  Glycerophospholipid metabolism
ola00565  Ether lipid metabolism
ola00590  Arachidonic acid metabolism
ola00591  Linoleic acid metabolism
ola00592  alpha-Linolenic acid metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101157546
   00565 Ether lipid metabolism
    101157546
   00590 Arachidonic acid metabolism
    101157546
   00591 Linoleic acid metabolism
    101157546
   00592 alpha-Linolenic acid metabolism
    101157546
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101157546
    3.1.1.32  phospholipase A1
     101157546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT NLPC_P60 Calici_PP_N Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 101157546
NCBI-ProteinID: XP_004073206
UniProt: H2LBM2
Position
10
AA seq 171 aa AA seqDB search
MAPTLYDVKPEPGDLIEIDRGSYQHWAVYVGDGFVVHMAPPFETPGARSNSIMSVLTEKA
MVKKEELWEVVGTDQWKISNSLDEEYEPRPAPVIVADACLLVGQERPYCVFTGNCEHFVN
ELRYGKAESRQVRKTGEAVMMAGVAAAVGLGIVALAGALFGGSNKKNKNNQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctccaacactgtacgatgtgaaacccgagccgggagacttgattgagatcgaccgt
ggctcttatcaacactgggctgtgtacgttggcgatggcttcgttgttcacatggcgccg
ccctttgagactccaggtgctcgttccaacagcatcatgtctgtcctaacggagaaggct
atggtgaagaaagaggagctctgggaggttgtgggaacagatcagtggaagatcagcaac
agtctggatgaagagtacgagccccggccggctccagttattgtggcagatgcctgcttg
ctggtgggccaggagcgaccatactgtgtcttcacggggaactgtgagcatttcgtcaat
gagctgcgctacggaaaagctgagtcccgacaggtgcgtaaaacaggagaggccgtgatg
atggcgggcgtggctgcagccgtgggcctgggtatcgtggctctggccggagcgctgttt
ggaggcagcaataagaaaaacaagaacaaccaatga

DBGET integrated database retrieval system