KEGG   Oryzias latipes (Japanese medaka): 101157651Help
Entry
101157651         CDS       T02443                                 

Gene name
mapk7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101157651 (mapk7)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101157651 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101157651 (mapk7)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101157651 (mapk7)
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101157651 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
19
AA seq 1127 aa AA seqDB search
MYDKVEFFCVYTHLGHPVIQADIVLTGFWCDISALGFHVGSIDKMATKNAVAGKIESNMA
SPERMATEKGREAQNQQGVEDADTSTTAKNLALLKAHSLDVKFDVGEEYDIIETIGTGAY
GVVSSARRRDNGQQVAIKKISNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPNLP
HSAFKSVYVVLDLMESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPS
NLLVNENCELKIGDFGMARGLSSHPEESYSFMTEYVATRWYRAPELLLSLNHYSLAIDLW
SVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPEGLISAIRAERVRSYVQSLPSRTA
VPLSKLYPQAEPDALDLLGAMLRFDPRQRIGVTEALEHPYLAKYHDPDDEPICVPAFDFE
FDKIAMSKEQIKDAILMEIQDFHKKKQSCRQKLQFKPLPRGNKGAAAQSNNQSNAPTADN
LTESSLLPMVPRAQQIQQQQNHPAEANQAFADQIKAFDKSAALLDVTRTCVTHNLSLLSK
TESGPVDVDMPSANSDSGQPETIDLTTPVSSQGASSEAMRDREVHEYLMNTQAQSAAQAP
TTAPPRRTAPIPASAHSLSLSVAQAHSLSQSLSQSLGKNSRSSQPAAEGTRKEGAISEDT
KNALKAVLLKSAIRQKARSDGGASAIGIDCGAGGGASSSLSSVLESRRSVTAQERQRERE
EKRKKRQERAREREKKMKEKERREGKQGDSLGGVLLSDNDKSLLQRWTRMMDSRCDKSQT
PNNDGCKNKDCNESSHTGAVTEITAETMNNKTDEARTFQAHNQLISQVNPNQHGLFQSPS
AQPPSLPFSMNQQTPSADLVTVNAGIDLMAMAGGFVKNALKPHPESGVQSRFGCLGNWSG
QQLATRPPHQPNRTTQPAPSSFLQPQTKADPQPQLLPLESFLSRAATLNAQETNGNMGIG
GQNNLNTMTGNSGQIEKLCSTLGGKPTSETRNPLCGTVGVSSQPHPSLVFTDTGQQGAPT
APDIHTVTLQLSKSQVEDILPPVFSVTPKGSGAGYGVGFDLDDLLNQSLTDLQNCDRDSY
DSAPLSASLLSDWSEVHRMTPADLESLQQELQLGSPMILSDGIAPDS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgtatgataaagttgaatttttttgtgtctatactcatttaggccacccagtaatccaa
gctgacattgttttaacaggtttctggtgtgacatttcagccctgggatttcatgtggga
agtatagataaaatggctacaaaaaatgctgtggctggaaaaattgagtccaacatggct
tcacctgaaagaatggccacggaaaagggcagagaagcccagaaccaacaaggagtggaa
gacgccgacaccagcacgacggcaaagaacctggcgttgctgaaagcacactctctcgat
gtgaagtttgacgttggggaggaatatgatatcatagaaaccattggtaccggggcatat
ggagtcgtttcatctgccagaagacgggacaatggccagcaggtggcaataaagaaaatc
tccaacgcttttgaggtggtgacaaatgccaaacgcaccttaagagagcttaagattctc
aaacatttcaaacatgacaacattatcgccatcaaagacatcctccagccaaatcttcct
cactcagccttcaagtctgtgtatgtggtgctggacctcatggagagtgaccttcatcag
atcatccactccacccaaacactaacccccgagcacacgcgctactttctctaccagctc
ctccgtggcctcaagtacgtgcactctgccaacgtcatccaccgcgacctcaaaccctcc
aacctgctggtgaatgaaaactgtgagctgaaaatcggggactttggcatggccaggggg
ctaagttcccaccccgaggagtcgtactccttcatgaccgagtatgtggcaactcgatgg
taccgcgctcctgagctgctcctctctctgaaccattacagtctggctattgacctgtgg
tctgtgggctgcatctttgcggaaatgttgggccgaaagcagctttttcctgggaaacac
tacgtccaccagcttcagctcattttaagtgtgttgggcacacctcctgagggtttaata
agcgctataagggctgaaagagtgcgctcctatgttcagagccttccatcacgaactgct
gtgcctttgtccaaactgtacccacaagctgaaccagatgccctggacttgctgggggcc
atgttgcgcttcgatccccgccaacgaatcggtgtgacggaggcactcgagcacccatac
ttggcgaaataccacgacccggatgacgagcctatatgcgttccagcttttgactttgaa
tttgataagattgcaatgagcaaggaacaaatcaaagatgccattttaatggaaatccag
gactttcataaaaagaaacaaagctgccgtcagaagctgcaattcaagccattgccgaga
gggaacaagggagccgctgcgcaaagtaataaccagagtaatgctccaactgctgacaat
ctgaccgaatcctcactgcttccaatggtaccaagagcacaacagatacagcagcagcaa
aaccatccagcagaagcaaaccaagcatttgctgatcagatcaaagcctttgacaagtct
gcagcccttttagatgtcaccaggacatgcgtgacccacaatttatcgcttctcagtaaa
actgaaagtggcccagttgacgtggatatgcccagtgccaactctgacagcggccagccg
gagacgatagatttaacgaccccagtgtctagtcagggtgcttcatcggaagcgatgaga
gaccgtgaagttcatgagtatttaatgaacactcaggctcagtcagcggcccaggctccc
accactgcaccgccacggaggacggcacccatacccgcctctgcccactccctgtctctg
tctgtggcacaggcccactcactctctcagtccctttcacagtcacttggcaagaactcg
aggagttctcaacctgcagcagagggaaccaggaaagagggcgccatttcagaggacacc
aaaaatgcccttaaggcagttttattaaagtctgccatcagacaaaaagccaggagtgat
ggaggagcctcggccatcggtattgactgcggtgcaggaggaggcgcctcatcctccctg
tcctctgttctagagtcccgtcggtctgtcacagcccaggagcgtcagcgggaaagagag
gagaaaagaaagaagaggcaggaacgagcaagagagagggagaaaaaaatgaaagaaaag
gaaagacgggagggaaaacagggggactctttgggtggggtgttgctgagtgacaacgac
aagagcttgttgcagcgctggacgaggatgatggacagccgctgcgacaaatctcaaact
cctaacaacgatggatgcaagaacaaggattgtaacgagagttctcacacgggtgcagtt
acagagatcaccgcggaaacgatgaacaataaaaccgacgaggcgagaacgtttcaggca
cacaaccagctaatctctcaagtaaacccgaaccagcatggcttgtttcagtcgcccagc
gctcaaccaccatcattgcctttctccatgaaccagcagaccccctcagctgatctagtt
actgtgaatgcagggatcgacttaatggccatggctggtgggttcgttaaaaacgccctg
aagcctcaccctgaaagtggcgtccaaagcaggtttggctgtttagggaattggagtggc
cagcaactggcgacgaggccgccacaccaaccaaacagaacgacacagccggcgccatcc
agcttcctgcagccccaaaccaaggctgacccgcagccacagctgctccctttagagagt
tttttgtcaagagcggcaaccctcaacgcccaagagaccaacgggaacatgggcatcgga
ggtcagaataacctcaatacgatgacaggaaattcagggcaaatagagaagctatgttct
acattaggagggaaaccaacatcagagaccagaaatcccctctgtgggacagtaggggtc
tcctctcagcctcatcccagcctggtgttcaccgatacaggacagcagggagcccctact
gctcctgacatccacacagtcaccctgcagctgtccaagtcccaggtggaggacatttta
ccgccggtgttctcagtcacccctaaaggcagcggtgctgggtatggcgtgggctttgat
ctggatgaccttctgaaccaatctctgacggacctgcaaaactgtgaccgggacagctat
gactcagcccccctctccgcctccctcttatccgactggagcgaggtgcaccgcatgact
ccagctgacctggagtcgctgcagcaggagctacagctcggctctcccatgatcctctct
gatggcatagctcccgactcctaa

DBGET integrated database retrieval system