KEGG   Oryzias latipes (Japanese medaka): 101157651Help
Entry
101157651         CDS       T02443                                 

Gene name
mapk7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101157651 (mapk7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101157651 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101157651 (mapk7)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101157651 (mapk7)
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101157651 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 1127 aa AA seqDB search
MYDKVEFFCVYTHLGHPVIQADIVLTGFWCDISALGFHVGSIDKMATKNAVAGKIESNMA
SPERMATEKGREAQNQQGVEDADTSTTAKNLALLKAHSLDVKFDVGEEYDIIETIGTGAY
GVVSSARRRDNGQQVAIKKISNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPNLP
HSAFKSVYVVLDLMESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPS
NLLVNENCELKIGDFGMARGLSSHPEESYSFMTEYVATRWYRAPELLLSLNHYSLAIDLW
SVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPEGLISAIRAERVRSYVQSLPSRTA
VPLSKLYPQAEPDALDLLGAMLRFDPRQRIGVTEALEHPYLAKYHDPDDEPICVPAFDFE
FDKIAMSKEQIKDAILMEIQDFHKKKQSCRQKLQFKPLPRGNKGAAAQSNNQSNAPTADN
LTESSLLPMVPRAQQIQQQQNHPAEANQAFADQIKAFDKSAALLDVTRTCVTHNLSLLSK
TESGPVDVDMPSANSDSGQPETIDLTTPVSSQGASSEAMRDREVHEYLMNTQAQSAAQAP
TTAPPRRTAPIPASAHSLSLSVAQAHSLSQSLSQSLGKNSRSSQPAAEGTRKEGAISEDT
KNALKAVLLKSAIRQKARSDGGASAIGIDCGAGGGASSSLSSVLESRRSVTAQERQRERE
EKRKKRQERAREREKKMKEKERREGKQGDSLGGVLLSDNDKSLLQRWTRMMDSRCDKSQT
PNNDGCKNKDCNESSHTGAVTEITAETMNNKTDEARTFQAHNQLISQVNPNQHGLFQSPS
AQPPSLPFSMNQQTPSADLVTVNAGIDLMAMAGGFVKNALKPHPESGVQSRFGCLGNWSG
QQLATRPPHQPNRTTQPAPSSFLQPQTKADPQPQLLPLESFLSRAATLNAQETNGNMGIG
GQNNLNTMTGNSGQIEKLCSTLGGKPTSETRNPLCGTVGVSSQPHPSLVFTDTGQQGAPT
APDIHTVTLQLSKSQVEDILPPVFSVTPKGSGAGYGVGFDLDDLLNQSLTDLQNCDRDSY
DSAPLSASLLSDWSEVHRMTPADLESLQQELQLGSPMILSDGIAPDS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgtatgataaagttgaatttttttgtgtctatactcatttaggccacccagtaatccaa
gctgacattgttttaacaggtttctggtgtgacatttcagccctgggatttcatgtggga
agtatagataaaatggctacaaaaaatgctgtggctggaaaaattgagtccaacatggct
tcacctgaaagaatggccacggaaaagggcagagaagcccagaaccaacaaggagtggaa
gacgccgacaccagcacgacggcaaagaacctggcgttgctgaaagcacactctctcgat
gtgaagtttgacgttggggaggaatatgatatcatagaaaccattggtaccggggcatat
ggagtcgtttcatctgccagaagacgggacaatggccagcaggtggcaataaagaaaatc
tccaacgcttttgaggtggtgacaaatgccaaacgcaccttaagagagcttaagattctc
aaacatttcaaacatgacaacattatcgccatcaaagacatcctccagccaaatcttcct
cactcagccttcaagtctgtgtatgtggtgctggacctcatggagagtgaccttcatcag
atcatccactccacccaaacactaacccccgagcacacgcgctactttctctaccagctc
ctccgtggcctcaagtacgtgcactctgccaacgtcatccaccgcgacctcaaaccctcc
aacctgctggtgaatgaaaactgtgagctgaaaatcggggactttggcatggccaggggg
ctaagttcccaccccgaggagtcgtactccttcatgaccgagtatgtggcaactcgatgg
taccgcgctcctgagctgctcctctctctgaaccattacagtctggctattgacctgtgg
tctgtgggctgcatctttgcggaaatgttgggccgaaagcagctttttcctgggaaacac
tacgtccaccagcttcagctcattttaagtgtgttgggcacacctcctgagggtttaata
agcgctataagggctgaaagagtgcgctcctatgttcagagccttccatcacgaactgct
gtgcctttgtccaaactgtacccacaagctgaaccagatgccctggacttgctgggggcc
atgttgcgcttcgatccccgccaacgaatcggtgtgacggaggcactcgagcacccatac
ttggcgaaataccacgacccggatgacgagcctatatgcgttccagcttttgactttgaa
tttgataagattgcaatgagcaaggaacaaatcaaagatgccattttaatggaaatccag
gactttcataaaaagaaacaaagctgccgtcagaagctgcaattcaagccattgccgaga
gggaacaagggagccgctgcgcaaagtaataaccagagtaatgctccaactgctgacaat
ctgaccgaatcctcactgcttccaatggtaccaagagcacaacagatacagcagcagcaa
aaccatccagcagaagcaaaccaagcatttgctgatcagatcaaagcctttgacaagtct
gcagcccttttagatgtcaccaggacatgcgtgacccacaatttatcgcttctcagtaaa
actgaaagtggcccagttgacgtggatatgcccagtgccaactctgacagcggccagccg
gagacgatagatttaacgaccccagtgtctagtcagggtgcttcatcggaagcgatgaga
gaccgtgaagttcatgagtatttaatgaacactcaggctcagtcagcggcccaggctccc
accactgcaccgccacggaggacggcacccatacccgcctctgcccactccctgtctctg
tctgtggcacaggcccactcactctctcagtccctttcacagtcacttggcaagaactcg
aggagttctcaacctgcagcagagggaaccaggaaagagggcgccatttcagaggacacc
aaaaatgcccttaaggcagttttattaaagtctgccatcagacaaaaagccaggagtgat
ggaggagcctcggccatcggtattgactgcggtgcaggaggaggcgcctcatcctccctg
tcctctgttctagagtcccgtcggtctgtcacagcccaggagcgtcagcgggaaagagag
gagaaaagaaagaagaggcaggaacgagcaagagagagggagaaaaaaatgaaagaaaag
gaaagacgggagggaaaacagggggactctttgggtggggtgttgctgagtgacaacgac
aagagcttgttgcagcgctggacgaggatgatggacagccgctgcgacaaatctcaaact
cctaacaacgatggatgcaagaacaaggattgtaacgagagttctcacacgggtgcagtt
acagagatcaccgcggaaacgatgaacaataaaaccgacgaggcgagaacgtttcaggca
cacaaccagctaatctctcaagtaaacccgaaccagcatggcttgtttcagtcgcccagc
gctcaaccaccatcattgcctttctccatgaaccagcagaccccctcagctgatctagtt
actgtgaatgcagggatcgacttaatggccatggctggtgggttcgttaaaaacgccctg
aagcctcaccctgaaagtggcgtccaaagcaggtttggctgtttagggaattggagtggc
cagcaactggcgacgaggccgccacaccaaccaaacagaacgacacagccggcgccatcc
agcttcctgcagccccaaaccaaggctgacccgcagccacagctgctccctttagagagt
tttttgtcaagagcggcaaccctcaacgcccaagagaccaacgggaacatgggcatcgga
ggtcagaataacctcaatacgatgacaggaaattcagggcaaatagagaagctatgttct
acattaggagggaaaccaacatcagagaccagaaatcccctctgtgggacagtaggggtc
tcctctcagcctcatcccagcctggtgttcaccgatacaggacagcagggagcccctact
gctcctgacatccacacagtcaccctgcagctgtccaagtcccaggtggaggacatttta
ccgccggtgttctcagtcacccctaaaggcagcggtgctgggtatggcgtgggctttgat
ctggatgaccttctgaaccaatctctgacggacctgcaaaactgtgaccgggacagctat
gactcagcccccctctccgcctccctcttatccgactggagcgaggtgcaccgcatgact
ccagctgacctggagtcgctgcagcaggagctacagctcggctctcccatgatcctctct
gatggcatagctcccgactcctaa

DBGET integrated database retrieval system