KEGG   Oryzias latipes (Japanese medaka): 101157788Help
Entry
101157788         CDS       T02443                                 

Definition
histone deacetylase 3-like
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101157788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 428 aa AA seqDB search
MSIRTSYFYDPDVGNFHYGAGHPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCR
FHSEDYIDFLQKVSPNNMQGFTKSLNTFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNH
KICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVI
KQVVDYYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKSFKIPLLVLGGGGYTV
RNVARCWTYETSLLLEESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQ
TVFENLKMLNHAPSVQIHDVPSDMLSYERTDDPDPDERGAEENYTRQEAANEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaggacgtcttacttttacgacccagatgtgggaaactttcattacggtgcc
ggtcatcccatgaagcctcaccgtttgtctctcacccacagtctggtgttgcattatggg
ttatataaaaagatgatggtttttaagccgtacaaagcctctcagcacgacatgtgccgg
ttccactctgaagattacatcgacttcctgcagaaggtcagccccaacaacatgcagggc
ttcaccaagagcctgaacaccttcaacgttggagatgactgtcctgtgtttccaggactc
tttgagttctgttccagatacacgggggcgtctctgcagggcgccacgcagctcaaccac
aagatctgtgacatcgccatcaactgggctggaggtttgcatcacgccaaaaaatttgag
gcgtcgggattttgctacgtgaacgacatcgtcatcagcatcctggagcttctcaagtac
cacccccgagttctgtacatcgacatcgacattcaccacggagacggcgtccaggaggcc
ttttacctgacggacagagtcatgaccgtgtccttccacaagtatgggaactacttcttc
ccgggaacgggtgacatgtacgaggtgggggccgagagcggacgctactactgcctcaac
gtccccctgcgagacggcatcgacgaccagagttaccggcagctgttccagccggtcatc
aagcaggtggtggattactaccagcccacctgcatcgtcctgcagtgtggggccgattcc
ctgggctgcgacagactgggctgcttcaaccttagcatacggggacacggggagtgcgtg
gagttcgtgaagagttttaagattcctctgctggtgctcggaggaggagggtacactgtg
aggaacgtggctcgctgctggacctatgagacatctctgctgctggaggaatccatcagc
gacgagctgccgtacagcgaatatttcgagtactttgccccagacttcacgctgcatcct
gatgtcagcaccaggatcgaaaaccagaactccagacagtatctggaacagatccgtcag
accgtgtttgaaaacctgaagatgttgaaccacgcgcccagcgtccagatccacgacgtc
ccgtcagacatgctgagctacgaacgcacagacgaccccgacccagacgagaggggagct
gaggagaactacacccgacaagaggcagcgaatgaattctacgacggcgaccatgacaac
gacaaagagagcgacgttgaaatttaa

DBGET integrated database retrieval system