KEGG   Oryzias latipes (Japanese medaka): 101157882Help
Entry
101157882         CDS       T02443                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ola00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ola00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ola04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 522 aa AA seqDB search
MGLLLPSSVFLLVLFTGAEVILSSGSSDCVARNFGHDSIVCECNSTHCDSIGPGNLPPVG
NFSSYLSSMAGSRLEASQGQIQVNSTGAGLRLTIVPHQKFQRIMGFGGAMTDAAAINILS
LSAGAQEQLLRQYFSRDGIGYSVVRVPMASCDFSTRLYTYADTPGDYNLANFTLAPEDIH
MKIPLLQRAQTLSPRPLSLLASAWSAPSWMKTNGALIGKGSLKGKPGGKEHKTWAQYYIR
FLEEYAKYNLTFWAVTTGNEPSAGRMTNYSFQALGFTAEEQRDWVALDLGPALHASAYPD
THILLLDDSRLLLPYWAKVVLNDVHAGRYIHGVAVHWYMDSLVPADISLGVTHQLYPEYY
LFGTEACAGWSSPDRGVKLGSWSRAEEYAHDILEDLNHHVVGWTDWNLALDPTGGPNWVK
NLVDSPIVVDAKRDVFYKQPSFYSMAHFSKFLLEDSQRVGVSSSGKTQLEYSAFVRPDSS
VVLVVLNKASSEIQFEVWDPAVGYIPCTAPAHSILTLAWNTR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggggctgttgttgccatcgtctgtatttttgttggttcttttcactggagcagaagtg
atcctcagttcaggaagctccgattgtgttgccagaaactttggccatgattccattgtg
tgtgagtgtaactccactcactgtgacagcattgggccggggaacttgcctccagtgggg
aacttctcctcctacctgagcagcatggcgggcagcaggctggaggccagccagggtcag
atccaggtgaacagcactggagcaggcctcagactgactattgttccacaccagaagttt
caaaggattatgggatttggtggagcaatgacagatgcagcggccatcaacatcctgtct
ctttctgctggtgcacaggagcagctgcttcgacagtacttctccagggacggaattggc
tacagcgttgtgcgcgtccccatggccagctgcgacttctccacccgcctctacacctac
gctgacacacctggagactacaacctggctaatttcactttggcccctgaggacattcac
atgaagatccctctcctgcagcgtgcgcagaccttatctcctcgtcctctctccctcttg
gccagtgcttggagcgcccccagttggatgaaaactaatggcgccctcataggaaagggc
tccctgaagggaaagccaggaggcaaggagcataaaacatgggctcagtactatatcaga
ttcctggaggagtatgctaaatataacctcaccttctgggctgtgactactggaaatgag
ccctctgcaggccgtatgacaaactacagcttccaggctctgggtttcactgcagaagag
cagagggactgggtagctttggacttgggccccgccctgcatgcctctgcgtacccagac
actcacatccttttgctggatgacagtcgcctgctgcttccttactgggctaaagtggtc
ctaaatgacgttcatgctggtcgatacattcatggggtggccgtccactggtacatggac
agtttagtccctgcagatataagcttaggggtgactcatcaactctatccagagtattac
ctcttcggcacagaggcctgcgctggctggagttcaccagacagaggagtgaagctggga
agctggagcagagctgaagagtacgctcacgacattctagaggacctaaatcaccatgtt
gtcggctggactgactggaatcttgcactagatccaactggtggaccaaactgggtgaaa
aacttagtggacagtccaatcgtggtggatgcaaagcgggacgtcttctacaaacagcct
tctttttacagcatggctcacttcagcaagttcctgttggaggactctcagagggtgggc
gtgtcttccagtgggaaaacgcagctggaatactcggccttcgtcagaccagacagctca
gtggttcttgtcgtactcaacaaggcatcgtctgagatccagtttgaagtctgggatccg
gctgtgggctacattccctgcactgctccagctcactccatactcacactggcctggaac
acacgctga

DBGET integrated database retrieval system