KEGG   Oryzias latipes (Japanese medaka): 101158311Help
Entry
101158311         CDS       T02443                                 

Definition
eukaryotic elongation factor 2 kinase-like
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     101158311
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   101158311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 712 aa AA seqDB search
MEEDLMFTMEEEGSAQRTSEQRNGIRPRPSSLSDANGTDDENDEHFISPILGDSAKEVCH
YLKNLGYTRQLSNSLPKTNFLYKAAWKNAIEKARAMPDPWAQFHLEEIPTESCMRYRYNA
ITGEWHQDQIHIKMGSQPFGKGAMRECFRSXVLVFIFCISKKKNALFLHNNNMEVGFHYV
AKRYMQEVDRDVYFEDVRLQMEAKLWGEEYNRHRPPKQVDIMQMCVVEMTNRPGKPLFHL
EHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIH
TEKGTDFGDGNLGVRGMALFFHSHMCNKICKSMGLTPFDLSPEEMSQLDGTNKLLKSAQT
VLRGCEEQCGSPRVRTWSASRAPPLFSRLSETSSADESMSDAESIPCSPLNPPFTAVGSL
GLSFTGMNEHERFSNNNQGEHKESESGGDSGYPSERRSEPDSSDHMDGLTDEKWSFFHSS
RSHVHRPSCVATEVERLNTLLQKKIGQSNLGKVHLAMVRYHEAGRFCEKDEQWDESSAMF
HLERAALCGELEAIVALGQCYLRLPHHILPDMELEDNAGNRMKGFKYLLQAAEAGDRSSM
IIVARAFDSGINLSADRKQDWAEAIHWYDSALNMSDFDEGGEFDGTQDEPRYLLLAREAE
MYQKGGHNLAADPQRAGDLFTEAAEAAMAAMKGRLANQYYMKAEEAWAEVEE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagacctgatgtttaccatggaggaggagggcagtgcccagaggacctccgag
cagaggaatggcatcagaccgcgaccttcctctctcagcgacgccaatggcaccgatgat
gagaatgatgaacatttcatctcaccaatcctgggtgactctgccaaagaggtttgccac
tacctgaaaaatctgggttacaccagacagctgtcaaactctctgcccaaaaccaacttt
ctgtacaaagcggcgtggaagaatgccattgaaaaggcccgagccatgcccgacccctgg
gcacagtttcatctggaggagattccaacagaatcctgcatgcggtacaggtacaatgcc
atcacaggggaatggcatcaagaccagatccacattaaaatgggttctcagccgtttgga
aagggagccatgagagagtgctttcgatcgtaagttttagtatttattttctgtatctca
aaaaagaaaaatgctttatttctgcacaataataacatggaagtcggcttccactatgtg
gcaaagcgttacatgcaggaggtggacagagacgtttactttgaggacgtcaggctgcaa
atggaggccaaactctggggagaggagtacaatcgacacagacctcccaaacaggttgac
atcatgcagatgtgtgtggtggagatgacaaacagacccggcaaacctctgttccaccta
gagcattacatcgagggcaagtacattaaatacaactccaactctggctttgtcagggac
gacaacatccgactcactccacaggctttcagtcacttcacctttgagcgctcgggccac
cagctgatcgtggtggacatccagggagtgggagatttgtacacggacccccagatccac
acggagaaggggactgacttcggagatgggaatctaggtgtgcggggcatggctctgttc
ttccactcccacatgtgcaacaagatctgcaagagcatgggcctgacgccgttcgacctt
tccccggaagaaatgtcccagctggacggcaccaacaaacttcttaaaagcgcacagacg
gtgctgaggggctgcgaggagcagtgcggctcgccccgagttcggacctggtctgccagc
cgggcgccgccgctcttctctcgcctgtccgagacgtcatctgcagacgagagcatgagc
gacgccgagtccatcccctgttcacctcttaatccccccttcacagcagtcggatctctg
ggcttatcttttactggaatgaatgaacatgaacgattcagcaataacaaccaaggggaa
cacaaggaatcagaaagcggtggagacagcggctaccctagtgagaggaggagcgaacca
gactccagcgaccacatggatgggctgacagatgagaaatggagcttcttccattcgtct
cgctctcatgtccaccgcccttcctgtgtggcgacagaagtggagcgcctcaacactctg
ctgcagaaaaagattggacagtcaaatctgggaaaggtccatctggccatggtccggtac
cacgaagcggggcgcttctgcgagaaggacgagcagtgggatgagagctccgccatgttc
cacctggagagagcggcgctgtgtggggagctggaggccatcgtagccttaggacagtgt
tacctccggttaccgcatcacatactgcctgacatggagttggaggacaacgctgggaac
cggatgaaaggtttcaaatatctgctgcaggccgctgaagctggagacagatcctccatg
atcatagtggccagagcctttgatagtggaatcaatctgtcggctgacagaaaacaagac
tgggctgaagcaattcactggtacgacagtgcgctgaacatgtcggactttgacgaaggc
ggggagttcgacggcacgcaggatgagccgcgatacctgctgctggccagagaagcggaa
atgtaccagaaggggggccacaacctggctgcagaccctcagagagcaggtgacctgttc
acagaggctgcagaagccgccatggcggccatgaaaggtcgcctggccaaccagtactac
atgaaagctgaagaggcctgggcagaagttgaggagtaa

DBGET integrated database retrieval system