KEGG   Oryzias latipes (Japanese medaka): 101158311Help
Entry
101158311         CDS       T02443                                 

Gene name
eef2k
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     101158311 (eef2k)
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   101158311 (eef2k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
19
AA seq 742 aa AA seqDB search
MEEDLMFTMEEEGSAQRTSEQRNGIRPRPSSLSDANGTDDENDEHFISPILGDSAKEVCH
YLKNLGYTRQLSNSLPKTNFLYKAAWKNAIEKARAMPDPWAQFHLEEIPTESCMRYRYNA
ITGEWHQDQIHIKMGSQPFGKGAMRECFRSKKLSNFSHSSNWKSASNYVAKRYMQEVDRD
VYFEDVRLQMEAKLWGEEYNRHRPPKQVDIMQMCVVEMTNRPGKPLFHLEHYIEGKYIKY
NSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGN
LGVRGMALFFHSHMCNKICKSMGLTPFDLSPEEMSQLDGTNKLLKSAQTVLRGCEEQCGS
PRVRTWSASRAPPLFSRLSETSSADESMSDAESIPCSPLNPPFTAVGSLGLSFTGMNEHE
RFSNNNQGEHKESESGGDSGYPSERRSEPDSSDHMDGVHQRYHRPYSESDEDSIRRKKMV
APPRVSANFNSCSPIYEALTDEKWSFFHSSRSHVHRPSCVATEVERLNTLLQKKIGQSNL
GKVHLAMVRYHEAGRFCEKDEQWDESSAMFHLERAALCGELEAIVALGQCYLRLPHHILP
DMELEDNAGNRMKGFKYLLQAAEAGDRSSMIIVARAFDSGINLSADRKQDWAEAIHWYDS
ALNMSDFDEGGEFDGTQDEPRYLLLAREAEMYQKGGHNLAADPQRAGDLFTEAAEAAMAA
MKGRLANQYYMKAEEAWAEVEE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagacctgatgtttaccatggaggaggagggcagtgcccagaggacctccgag
cagaggaatggcatcagaccgcgaccttcctctctcagcgacgccaatggcaccgatgat
gagaatgatgaacatttcatctcaccaatcctgggtgactctgccaaagaggtttgccac
tacctgaaaaatctgggttacaccagacagctgtcaaactctctgcccaaaaccaacttt
ctgtacaaagcggcgtggaagaatgccattgaaaaggcccgagccatgcccgacccctgg
gcacagtttcatctggaggagattccaacagaatcctgcatgcggtacaggtacaatgcc
atcacaggggaatggcatcaagaccagatccacattaaaatgggttctcagccgtttgga
aagggagccatgagagagtgctttcgatcgaagaagttgtccaatttttctcacagcagc
aactggaagtcggcttccaactatgtggcaaagcgttacatgcaggaggtggacagagac
gtttactttgaggacgtcaggctgcaaatggaggccaaactctggggagaggagtacaat
cgacacagacctcccaaacaggttgacatcatgcagatgtgtgtggtggagatgacaaac
agacccggcaaacctctgttccacctagagcattacatcgagggcaagtacattaaatac
aactccaactctggctttgtcagggacgacaacatccgactcactccacaggctttcagt
cacttcacctttgagcgctcgggccaccagctgatcgtggtggacatccagggagtggga
gatttgtacacggacccccagatccacacggagaaggggactgacttcggagatgggaat
ctaggtgtgcggggcatggctctgttcttccactcccacatgtgcaacaagatctgcaag
agcatgggcctgacgccgttcgacctttccccggaagaaatgtcccagctggacggcacc
aacaaacttcttaaaagcgcacagacggtgctgaggggctgcgaggagcagtgcggctcg
ccccgagttcggacctggtctgccagccgggcgccgccgctcttctctcgcctgtccgag
acgtcatctgcagacgagagcatgagcgacgccgagtccatcccctgttcacctcttaat
ccccccttcacagcagtcggatctctgggcttatcttttactggaatgaatgaacatgaa
cgattcagcaataacaaccaaggggaacacaaggaatcagaaagcggtggagacagcggc
taccctagtgagaggaggagcgaaccagactccagcgaccacatggatggggtgcaccag
cgctaccacagaccttactcagagtcggatgaggacagtatcagacggaagaagatggta
gctcctccaagagtctctgcaaactttaactcatgcagtcccatctatgaagcgctgaca
gatgagaaatggagcttcttccattcgtctcgctctcatgtccaccgcccttcctgtgtg
gcgacagaagtggagcgcctcaacactctgctgcagaaaaagattggacagtcaaatctg
ggaaaggtccatctggccatggtccggtaccacgaagcggggcgcttctgcgagaaggac
gagcagtgggatgagagctccgccatgttccacctggagagagcggcgctgtgtggggag
ctggaggccatcgtagccttaggacagtgttacctccggttaccgcatcacatactgcct
gacatggagttggaggacaacgctgggaaccggatgaaaggtttcaaatatctgctgcag
gccgctgaagctggagacagatcctccatgatcatagtggccagagcctttgatagtgga
atcaatctgtcggctgacagaaaacaagactgggctgaagcaattcactggtacgacagt
gcgctgaacatgtcggactttgacgaaggcggggagttcgacggcacgcaggatgagccg
cgatacctgctgctggccagagaagcggaaatgtaccagaaggggggccacaacctggct
gcagaccctcagagagcaggtgacctgttcacagaggctgcagaagccgccatggcggcc
atgaaaggtcgcctggccaaccagtactacatgaaagctgaagaggcctgggcagaagtt
gaggagtaa

DBGET integrated database retrieval system