KEGG   Oryzias latipes (Japanese medaka): 101158373Help
Entry
101158373         CDS       T02443                                 

Definition
histone deacetylase 10-like
Orthology
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101158373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 534 aa AA seqDB search
MGTALIYDEEMTKYKLLWVDPACKIEVPERLTVSHGALVRNGLTDRCICLPVREAVDAEI
LLVHSEEYLEAVKQTPHMTLEDLKEFTLQYGDVYFHPNIYHCAKLAVGSALQLVDSVLMG
KVKNGMALVRPPGHHSMRSAANGFCVFNNVAIAAQYAKQKYGVKRILIVDWDIHHGQGVQ
YCFEDDPSVLYFSWHRYEHQKFWPNLKDSDYDIVGKGEGAGFNINVPWNKVGMENSDYLS
VFCHVLLPIAYEFCPDLVLVCAGFDSAIGDLEGEMCATPDIFAHLTYLLMNLAEGKLCAV
LEGGYNLTSLAQSVCQTVQTLLGDPLPPLTNLTGPCRSTLESLQCVRAAHRQHWSCLRHA
VDLPTFEISTIRIKSSGEENKDEAEVWEEQKSPEEKIWPEPPKRVSPRGCTDTSGFAQAM
FSLLLPLGYQHNPSLVLLVRMPGSGVCDIMWQQLTALLQSFAQGHTLVLLQEDDKACVGP
TASILLGNPAPPLGQLPASLKEDAEAVERLRSRLQADWNLLLATAPENGGTDEG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgctctgatttatgatgaggaaatgaccaaatacaaactgctttgggttgat
ccagcatgtaagattgaagtaccggagcgcttgacagtgagtcacggtgctttggtcaga
aatgggctcaccgatcgctgtatctgtcttcctgtccgtgaggcggtggatgcagagatt
cttttggtccacagtgaggaatatctggaggcagtgaaacagactcctcatatgacttta
gaagacttgaaagagttcactctccagtatggtgacgtttacttccaccctaacatctat
cactgtgccaagctggctgtagggtctgcattgcaactggtggacagcgttctgatggga
aaggtgaaaaacggcatggctttggtcagacctccgggtcaccacagcatgcgcagtgca
gccaacggtttctgtgtgttcaacaacgtggccatagcagctcaatatgcaaagcagaaa
tatggagtcaaaaggattttgatagtcgactgggatatccatcatggtcaaggagtgcag
tattgctttgaggatgacccaagtgttctctacttttcttggcaccggtatgagcatcag
aaattctggcccaatctcaaagattctgactatgacattgttggcaaaggggaaggagct
gggttcaacataaacgtgccatggaacaaggtgggaatggagaacagtgattacctctca
gttttctgtcacgtccttctgccaatcgcctatgagttttgtccagatttggttttggtg
tgtgcagggtttgactcagccattggtgacctagagggggaaatgtgtgccactcctgac
atctttgcccacttgacttatctgctgatgaacttggcagaagggaaactgtgtgctgtt
ctggagggaggatacaacctgacttccctggcacagtctgtgtgtcagacagttcagact
ctacttggagatcctcttcctccgctcacgaatctcactggtccctgcagaagcacgctc
gagtcccttcagtgtgtcagggcagctcacagacaacattggtcttgcctcagacatgca
gtggatctgcccacctttgagatcagtaccatacgcatcaaatcatctggagaagagaac
aaagatgaagcggaagtttgggaggagcagaagagcccagaggaaaagatttggcctgag
cctccaaagcgcgtctctcctcgtggctgcaccgacacctcaggctttgcacaggcaatg
tttagcctcctcttacccctcggatatcaacacaaccctagtcttgtcttgctggttcgg
atgcctggtagtggagtgtgtgacatcatgtggcagcagctgacggccctgctgcagagc
tttgctcaaggacacacgctggtattactgcaggaggatgataaggcatgtgtgggccca
acagcctccatcctgctggggaaccctgctcctccattgggacagcttccggcttcgttg
aaggaggatgctgaagctgtggagagactgagaagcaggctgcaggctgactggaacctt
ttgctggcaacggcaccagaaaatggagggactgatgaaggttga

DBGET integrated database retrieval system