KEGG   Oryzias latipes (Japanese medaka): 101158849Help
Entry
101158849         CDS       T02443                                 

Definition
alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101158849
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101158849
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101158849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 525 aa AA seqDB search
MLSALLIICSCLSVRSSGKPMFPENEKSPAFWNNGAQKTLKEALSTQELNKNKAKNLILF
LGDGMGVPTVTAARILKGQLNGQSGEEYQLEMDKFPFVSLSKTYNTDAQVPDSAGTATAY
LCGVKANEGTVGVSAAAVRSQCNTTKGNEVTSILKWAKDAGKSVGIVTTTRINHATPSAA
YAHSVDRDWYSDNEMPSEALQAGCKDIARQLFENIPNIDVIMGGGRKYMFPKNMSDVDYP
GVAKYNGVRNDGRNLVQEWIDRMKDQGGHYVWNKQQLLSLNPKKTSYLLGLFGPVDLPYD
LERNADSDPSLTQMVEVAIKVLQNNPKGFYLLVEGGRIDHGHHEGKAKQALYEAVEMDRA
IGRADLLTSAQDTLTVVTADHSHVFTFGGYTRRGNTIFGLAPMVSDVDHKPFTSILYGNG
PGYKLVGGARENVSTVDFAENNYKAQSAVPLTSETHGGEDVAVFAKGPLAHLLHGVHEQN
FIPHVMAYAACIGQNRGHCPSGGTAALRPVFSSMAAVLTVTLLLC
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcggctctgctcatcatctgctcctgtctcagtgtgaggagttcagggaagccg
atgtttcctgaaaatgagaaaagtccggctttctggaacaacggggctcagaagaccctg
aaggaggctctgagcacgcaggagctgaacaagaacaaagcaaagaacctcatccttttc
ctcggggacgggatgggcgttcccacggtgaccgctgctcggatcctgaagggtcagctg
aacggacagagcggagaagagtaccagctggagatggacaagttcccgtttgtgtcattg
tccaagacatacaacacagacgcacaggtacccgacagcgcgggaacggccacagcttac
ctgtgtggggtaaaagccaacgagggcacggtgggtgtgagcgccgccgccgtccggtct
cagtgcaacaccacgaagggcaacgaagtcacctccatcctaaaatgggccaaagatgca
ggaaagtctgtgggaatagtgacgacaacacgtattaaccacgcaactccgagcgctgcc
tacgctcacagcgtcgacagggactggtactccgacaacgagatgcctagtgaagctctg
caggccggctgcaaggacatcgccagacagctctttgaaaacatcccaaacattgatgtg
atcatggggggaggaaggaaatatatgttccccaaaaacatgtcggatgtagattatcct
ggtgtggcgaagtacaatggcgtacgaaacgacgggaggaacttagtgcaggagtggatt
gacaggatgaaagaccagggaggccattatgtgtggaacaagcaacagcttctctccctg
aatcctaagaagactagttacttactgggtctttttggacctgtggatctgccttatgac
ttggagaggaatgccgactcagatccttcgttgacacagatggtagaagttgccatcaag
gtacttcagaacaatcccaaggggttttacctgctcgtagaaggcggacgcattgaccat
ggacaccacgagggcaaagccaagcaggctctttatgaggcggtggaaatggaccgggct
attggccgtgccgacctcctgacctccgcccaagatacactgacggtggtcaccgctgac
cattcccacgtgtttacctttggaggctacaccagaagaggaaatacgatatttggtctt
gcccccatggtcagtgatgtggatcataagcctttcacgtccatcttgtatgggaacgga
cccggttacaaacttgtgggcggtgcaagagagaacgtttccaccgttgactttgcggaa
aacaactacaaggcccaatccgccgtccctttgacctccgagactcatgggggggaggac
gtggctgtgtttgctaaggggccgctggctcacctgctgcatggagtccatgagcagaac
ttcatcccacacgtgatggcgtacgcagcttgtatcgggcagaaccgggggcactgtccg
tccggggggacggcagccttgaggcccgttttctccagcatggccgccgttctgacagta
accctgcttctatgctga

DBGET integrated database retrieval system