KEGG   Oryzias latipes (Japanese medaka): 101158956Help
Entry
101158956         CDS       T02443                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101158956
Enzymes [BR:ola01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     101158956
Peptidases [BR:ola01002]
 Cysteine Peptidases
  Family C44
   101158956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 561 aa AA seqDB search
MCGIWALFGSDECLSVQCTCAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQ
PLRIKKFPYLWLCYNGEIYNHHTLQKTFDFDFQTKVDGEVLLHLYDRFGIKKMASLLDGV
FAFILLDTANRKVHLGRDTYGVRPLFKLLTDDGFLAVCSEAKGLTNISHSMSEEVSIEPF
LPGHIEVFDLKLSGKVQSLQMEPFHCCTQEPTHALYDPLQTLPAGLDEETVKSNIRSLLE
NAVRKRLMAHRRIGCLLSGGLDSSLIAALLVKLAKEEKLPYKIQTFSIGSEDSPDILAAR
KVAAHIGSEHHEVNFTAEEGIRAVEEVIFHLETYDITTIRASVGMFLVSKHIREKTDSVV
IFSGEGSDELTQGYIYFHKAPSAAAAAKDSVRLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFTAYYLSLPENMRVPKDGVEKHLLRDSFKGLNLIPEEILWRRKEAFSDGMMSMKKS
WYTCLQEHLEAIVNDDQMEKASKTFPHNPPTTKEAYYFRQVFEKLYPGRAQWLSHYWMPR
WIEAADPSARTLSIYEPDKDQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatctgggctttgttcggcagcgatgagtgcctgtcggtccagtgcacgtgt
gccatgaaaatcgcccacagaggcccggacgcattccgcttcgagaacgtcaacggcttc
accaactgctgcttcggcttccaccggctcgccatcgtggatcagctgtacgggatgcag
ccgctgcgcatcaagaagttcccgtacctgtggctgtgctacaatggggagatctacaac
caccacacgctccagaagacttttgactttgacttccaaaccaaagtggacggtgaggta
ctgctccatctctatgaccgttttggcattaaaaaaatggcctccctcctggacggcgtc
ttcgccttcatcctgctggacacggccaacagaaaggtgcacctggggagggatacctac
ggcgtgcggcccttgttcaagctcctgaccgacgatggcttcctggctgtctgctctgaa
gcaaaaggtctcaccaacatcagccactccatgagcgaggaggtcagcatcgagcccttc
ctgccgggacacatcgaggtgtttgacctgaagctgagcgggaaggtccagtcccttcag
atggagccgttccactgctgcacgcaggagccgacgcacgccctctacgatcctctgcag
acacttcctgcaggtttggatgaagaaaccgtgaaaagcaacatcaggagcctgctggag
aacgccgtgaggaagcggctgatggcccaccggcggatcggctgcctcctatcaggtggc
ctggactccagcctgatcgccgctctgctcgtgaagctggccaaagaggagaagctgccg
tacaaaattcagacgttttccatcggatcggaagatagtccggacattctggctgctcgc
aaggtggcggcacacattggcagcgagcaccacgaggtgaacttcactgcggaggagggc
atccgcgccgtggaggaggtcattttccacctggagacctatgatatcaccaccatccga
gcctcagtcggaatgtttttggtgtccaagcacatccgagagaagacggacagcgtggtg
atcttctctggagaaggatctgacgagctcactcagggatacatctacttccacaaggct
ccatctgccgcagcagcagctaaggacagcgtccgtctgctgaaggaactgtacttgttt
gacgttctccgggccgaccgcaccactgccgcccacgggctggagctcagggttcccttt
ctggatcacagatttactgcatactacctgtccctccctgagaacatgagagttcctaag
gatggagtggagaagcatctcctccgggattctttcaaaggtctcaacctaatcccagag
gagatcctgtggaggcggaaggaggccttcagtgatgggatgatgtccatgaagaagtcc
tggtacacctgtctgcaggagcacctggaggccatcgtcaacgacgaccagatggaaaag
gcctcaaagacgtttccccacaacccccccaccaccaaagaggcctactacttcaggcag
gtgtttgagaagctgtacccgggccgagctcagtggctctcccactactggatgccgcgc
tggatcgaagcggccgacccgtcggcccgaaccctgtccatctacgagcccgacaaggac
cagtga

DBGET integrated database retrieval system