KEGG   Oryzias latipes (Japanese medaka): 101159205Help
Entry
101159205         CDS       T02443                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101159205
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101159205
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101159205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 792 aa AA seqDB search
MADSAGIQQGSPAIGAAGLVPAAPGAGGTEGSGAAGGSARIVAKKAQLRSSPRPKKLEKL
GIYSSCKAEGPCKCNGWKSQNPPPTPPQTDQQTNTVNLQEPCRSCSHTLGDHVSHLENIS
EEEMNRLLGVVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPNEETA
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTIMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHSSXIWSLEFLAGTTGGQIPVQTVISAPPVTRSLYYS
ASPVSVEPSTCGSVSPARKPNPTLESNPVGEKRKASEPLHHEENKRPRVMGDIPMDLINE
VMATITDPATIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPAGKGKELKDPEQLYTTLKSILQHVKSHQNAWPFMEPVKKTEAPGY
YQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFF
YGKIKEAGLIEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcgctggaattcaacaaggctcgccggccatcggagccgccggccttgtc
ccagccgcccccggtgccgggggaacggaaggctccggcgccgctggaggatccgcacgt
atcgtcgcgaagaaggcgcaactccgctcctcgcctcggccgaagaaactggaaaaactc
ggaatttattcgtcatgcaaagctgaggggccctgtaaatgtaatggctggaaaagccag
aacccccctcccacacccccccaaaccgaccagcagaccaacacagtgaacctacaggag
ccctgccgcagctgctcccacactctgggcgatcacgtgagccatctagaaaatatatcg
gaagaggaaatgaaccgactcctaggtgtcgtcctggacgtggaatacctgtacacgtgt
gtccacaaagaggaggatgctgacactaaacaagtctacttttcactgtttaagctttta
aggaaatccatcttgcagatgggtaaaccgatgttggaagcacaagagagtcctcctttt
gaaaaacccagcattgaacagggagtgaacaactttgtccagtacaaatttagccatcta
ccatcaaaagagcgtcaaaccatcatggagctggcgaagatgtttcttaaccaaatcaac
tactggcagctggaaacaccgtctcaaaggcgccagagggttccgaacgaggaaacggcg
ggatacaaagtcaactacaccaggtggctgtgctactgcaatgtgccccagttctgcgac
agcctgccgcggtacgaaaccacccagatcttcggtcggacgctgttgcgttctgtgttc
accatcatgaggaagcagctgctggagcaggccaggcaggagaaggacaagctgccccca
gagaagcgcacgctcattctgacacactttccaaagttcttgtcgatgttggaggaggag
gtgtacagtcacagctctnctatctggagtctggagtttttggcaggaactacaggcggg
cagattcccgttcagactgtgatcagcgcacccccagtgacgaggtcactgtactacagc
gccagtccggtttcggtggagccatccacatgcggaagcgtcagtcctgccaggaaaccc
aaccctactttggagtcgaacccagtgggagaaaaacgcaaagcctctgaaccccttcac
cacgaagaaaacaaaagaccacgggtgatgggtgacatccccatggatctcatcaacgaa
gtcatggcgaccatcaccgaccctgccaccattccagagacaagtctactgtctgctcat
tcggctcgtgacgaagctgcgcgccttgaggagcggcgaggagtgattgagttccacgtc
atcgggaactcgctgaaccaaaagcccaacaaaaggatcttgatgtggctggtggggctt
cagaatgtgttctcgcaccagctgccccgcatgcccaaagagtacatcacacggctggtg
tttgacccgaagcacaagacgctgtcattaatcaaggacgggcgtgtgattggaggaatc
tgcttccggatgtttccgtcgcagggtttcacagagatcgtcttttgtgcggtcacatct
aacgaacaagttaaaggctacggaacccacctgatgaaccacctgaaggaataccacatt
aagcatgaaattctcaacttcctcacgtatgccgacgagtacgccatcgggtactttaag
aaacagggtttttcaaaggacatcaaagttcccaagtcgaagtatgtgggctacatcaag
gactacgaaggagccacgctcatgggctgtgaactcaatcccagcatcccgtacaccgag
ttctcggtgatcatcaaaaagcagaaggagatcattaagaagctgatcgaaaggaagcag
gctcagatcagaaaggtctacccaggactgtcctgttttaaggacggagtccggcagatt
cccatcgagagcattcctggcatacgcgaaactggatggaagcctgcaggtaaagggaag
gaactgaaggatccagagcaactgtacaccactctgaagtccatcctccagcatgtgaag
agccaccaaaacgcctggcccttcatggaacccgtgaagaaaacagaggcaccgggttac
taccaagtcattcgctttcccatggacctgaaaaccatgagcgagcgcctgaagagcagg
tactacaccacgcgcaagctgttcatggccgacatgcagcgcatcttcaccaactgccgg
gaatacaacccaccggaaagcgagtactacaagtgcgctaacctactggagaaattcttc
tacggcaagatcaaggaagcaggtctcattgagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system