KEGG   Oryzias latipes (Japanese medaka): 101159205Help
Entry
101159205         CDS       T02443                                 

Gene name
kat2b
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101159205 (kat2b)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101159205 (kat2b)
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101159205 (kat2b)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101159205 (kat2b)
   HAT complexes
    PCAF complex
     101159205 (kat2b)
    STAGA complex
     101159205 (kat2b)
    TFTC complex
     101159205 (kat2b)
    SAGA complex
     101159205 (kat2b)
    SLIK complex
     101159205 (kat2b)
    ADA-HAT complex
     101159205 (kat2b)
    HAT-A2 complex
     101159205 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 794 aa AA seqDB search
MADSAGIQQGSPAIGAAGLVPAAPGAGGTEGSGAAGGSARIVAKKAQLRSSPRPKKLEKL
GIYSSCKAEGPCKCNGWKSQNPPPTPPQTDQQTNTVNLQEPCRSCSHTLGDHVSHLENIS
EEEMNRLLGVVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPNEETA
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTIMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHSSXIWSLEFLAGTTGGQIPVQTVISAPPVTRSLYYS
ASPVSVEPSTCGSVSPARKPNPTLESNPVVVGEKRKASEPLHHEENKRPRVMGDIPMDLI
NEVMATITDPATIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLV
GLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAV
TSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGY
IKDYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVR
QIPIESIPGIRETGWKPAGKGKELKDPEQLYTTLKSILQHVKSHQNAWPFMEPVKKTEAP
GYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEK
FFYGKIKEAGLIEK
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcgctggaattcaacaaggctcgccggccatcggagccgccggccttgtc
ccagccgcccccggtgccgggggaacggaaggctccggcgccgctggaggatccgcacgt
atcgtcgcgaagaaggcgcaactccgctcctcgcctcggccgaagaaactggaaaaactc
ggaatttattcgtcatgcaaagctgaggggccctgtaaatgtaatggctggaaaagccag
aacccccctcccacacccccccaaaccgaccagcagaccaacacagtgaacctacaggag
ccctgccgcagctgctcccacactctgggcgatcacgtgagccatctagaaaatatatcg
gaagaggaaatgaaccgactcctaggtgtcgtcctggacgtggaatacctgtacacgtgt
gtccacaaagaggaggatgctgacactaaacaagtctacttttcactgtttaagctttta
aggaaatccatcttgcagatgggtaaaccgatgttggaagcacaagagagtcctcctttt
gaaaaacccagcattgaacagggagtgaacaactttgtccagtacaaatttagccatcta
ccatcaaaagagcgtcaaaccatcatggagctggcgaagatgtttcttaaccaaatcaac
tactggcagctggaaacaccgtctcaaaggcgccagagggttccgaacgaggaaacggcg
ggatacaaagtcaactacaccaggtggctgtgctactgcaatgtgccccagttctgcgac
agcctgccgcggtacgaaaccacccagatcttcggtcggacgctgttgcgttctgtgttc
accatcatgaggaagcagctgctggagcaggccaggcaggagaaggacaagctgccccca
gagaagcgcacgctcattctgacacactttccaaagttcttgtcgatgttggaggaggag
gtgtacagtcacagctctnctatctggagtctggagtttttggcaggaactacaggcggg
cagattcccgttcagactgtgatcagcgcacccccagtgacgaggtcactgtactacagc
gccagtccggtttcggtggagccatccacatgcggaagcgtcagtcctgccaggaaaccc
aaccctactttggagtcgaacccagtcgtagtgggagaaaaacgcaaagcctctgaaccc
cttcaccacgaagaaaacaaaagaccacgggtgatgggtgacatccccatggatctcatc
aacgaagtcatggcgaccatcaccgaccctgccaccattccagagacaagtctactgtct
gctcattcggctcgtgacgaagctgcgcgccttgaggagcggcgaggagtgattgagttc
cacgtcatcgggaactcgctgaaccaaaagcccaacaaaaggatcttgatgtggctggtg
gggcttcagaatgtgttctcgcaccagctgccccgcatgcccaaagagtacatcacacgg
ctggtgtttgacccgaagcacaagacgctgtcattaatcaaggacgggcgtgtgattgga
ggaatctgcttccggatgtttccgtcgcagggtttcacagagatcgtcttttgtgcggtc
acatctaacgaacaagttaaaggctacggaacccacctgatgaaccacctgaaggaatac
cacattaagcatgaaattctcaacttcctcacgtatgccgacgagtacgccatcgggtac
tttaagaaacagggtttttcaaaggacatcaaagttcccaagtcgaagtatgtgggctac
atcaaggactacgaaggagccacgctcatgggctgtgaactcaatcccagcatcccgtac
accgagttctcggtgatcatcaaaaagcagaaggagatcattaagaagctgatcgaaagg
aagcaggctcagatcagaaaggtctacccaggactgtcctgttttaaggacggagtccgg
cagattcccatcgagagcattcctggcatacgcgaaactggatggaagcctgcaggtaaa
gggaaggaactgaaggatccagagcaactgtacaccactctgaagtccatcctccagcat
gtgaagagccaccaaaacgcctggcccttcatggaacccgtgaagaaaacagaggcaccg
ggttactaccaagtcattcgctttcccatggacctgaaaaccatgagcgagcgcctgaag
agcaggtactacaccacgcgcaagctgttcatggccgacatgcagcgcatcttcaccaac
tgccgggaatacaacccaccggaaagcgagtactacaagtgcgctaacctactggagaaa
ttcttctacggcaagatcaaggaagcaggtctcattgagaagtag

DBGET integrated database retrieval system