KEGG   Oryzias latipes (Japanese medaka): 101159289Help
Entry
101159289         CDS       T02443                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101159289
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101159289
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101159289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
15
AA seq 355 aa AA seqDB search
MKRRNLQQKPSPSKPTRTRKSGRTEKHERLQPWIKWGLLAAFVVVIVIPVTLVVMPEILQ
QFVYKYRLRVPFFVDLSRPADFSLNHTINMYLTTEEGISLGVWHTVPAHRLGEAQGKDLA
WYQNSLRDGSPVFIYFHGNTGTRAAVHRVGVAKLLSALGYHVLVPDYRGFGDSTGEPTES
GLTTDATYLYNWVKARSGDSLVVIWGHSLGTGVTTNTAVKLLDQGVVFDGVILEGAFNSQ
RQQIPYDPFTWYYCRLPSLESLCYLFAKPLAKDTIMFPSEQNLKKMKSPILFLHSEDDHL
VPIEIARQTYEVAANAQSSNRVRLVTFDGSLGYLHNGLYRDPKLPGIIKEFVQSL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaagaaacctccagcagaaaccgtctccttccaaaccgaccagaacccggaag
tctggcagaaccgagaagcatgaacggctccagccgtggatcaagtgggggttactggct
gcctttgttgtcgtcattgtgattcctgtcacactggtagtgatgccggaaatacttcag
cagtttgtgtacaagtacagactcagagtgccgttctttgtggacctaagccggcctgct
gacttctcccttaatcacaccatcaacatgtatctgaccacagaggaaggaatttccctt
ggtgtgtggcacactgtccctgcacatcgcttgggagaggctcaagggaaggaccttgct
tggtaccagaactctttaagggatggaagtccagtttttatatattttcatggaaacaca
ggcacgagagcagctgtacaccgagtgggcgtggctaaattactgagtgcgcttggctac
catgtgctggtccctgactacagaggttttggagattccacgggagagccaacagagtcc
ggtctgaccacggatgccacctacttgtacaactgggtcaaagcacgcagtggagacagc
cttgttgtgatctggggtcactctcttggcactggggtgaccaccaacactgcagtcaaa
ctattggatcaaggtgtggtctttgatggcgtgatcctggaaggagcgttcaacagccag
cgacagcagatcccatatgatcccttcacctggtattactgcagattaccaagtttggaa
agcctctgttacttgtttgcgaagccactagcaaaagataccatcatgttcccctctgaa
caaaatttgaagaaaatgaagagcccaatacttttccttcattcagaggacgaccattta
gttcccatagaaatcgcccgtcagacgtatgaagtggctgcgaatgcgcagagttccaac
cgagtcaggctggtgacctttgacggttctctgggatatctgcacaacggcctatacaga
gaccccaaactgccaggcatcataaaggagtttgttcagtctttataa

DBGET integrated database retrieval system